Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

781 – 795 of 129,988 results

781

Invitrogen™ Human PIK3C2A (PI3K-C2 alpha), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	171.1 kDa
Formulation	proprietary buffer with no preservative
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human PIK3C2A (PI3K-C2 alpha), GST Tag
Recombinant	Recombinant

782

Invitrogen™ Human PASK, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	77.2 kDa
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human PASK, GST Tag
Recombinant	Recombinant

783

Invitrogen™ Human CF106 (aa 1-76) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNISVPSMS
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human CF106 (aa 1-76) Control Fragment
Recombinant	Recombinant

784

Invitrogen™ Human RPS6KB1 (p70S6K), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	p70 S6 Kinase
Molecular Weight (g/mol)	75.1 kDa
KinaseFamily	RSK (RPS6K) Kinase Family
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human RPS6KB1 (p70S6K), GST Tag
Accession Number	P23443
Gene Alias	10539; 2610318I15Rik; 4732464A07Rik; 70 kDa ribosomal protein S6 kinase 1; 7084; 70 kDa; 7-10; AA959758; AI256796; AI314060; CG10539; CG10539-PA; CG10539-PB; Dmel\CG10539; Dmel_CG10539; Dp70[s6k]; Dp70S6k; dps6k; dS6 kinase; dS6K; d-S6K; dS6K1; EC 2.7.11.1; fs(3)07084; hypothetical protein; kinase p70S6K; KS6B1; l(3)07084; p70 p70-S6K; p70 ribosomal S6 kinase; p70 ribosomal S6 kinase alpha; p70 S6 kinase; p70 S6 kinase 1; p70 S6 kinase alpha; p70 S6 kinase, alpha; p70 S6K; p70 S6KA; p70 S6K-alpha; p70(S6K)-alpha; p70/85s6k; p70/S6K; p70[S6 kinase]; p70[S6k]; p70[S6kinase]; p70-alpha; p70S6 kinase; p70S6k; p70-S6K; p70-S6K 1; p70S6K kinase; p70s6k protein kinase homolog; P70S6K1; p70S6K-alpha; p80-S6K 1; p85 p85S6K; Pk.?6; Pk64F; protein kinase-like 64 F; PS6K; p-S6K; ribosomal protein S6 kinase; ribosomal protein S6 kinase B1; ribosomal protein S6 kinase beta-1; Ribosomal protein S6 kinase I; ribosomal protein S6 kinase polypeptide 1; ribosomal protein S6 kinase, 70 kD, polypeptide 1; ribosomal protein S6 kinase, 70 kDa, polypeptide 1; ribosomal protein S6 kinase, polypeptide 1; ribosomal S6 protein kinase; Rps6kb1; RPS6-p70-protein kinase; S6 K; S6 kinase; s6k; S6K kinase; S6K1; s6k11; S6K-beta-1; S6kinase; S6-kinase; S6k-PA; S6k-PB; serine/threonine kinase 14 alpha; serine/threonine-protein kinase 14 A; STK14A
Protein Length	1-421
Gene ID (Entrez)	6198
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

785

Invitrogen™ Human DDR1, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	MCK10
Molecular Weight (g/mol)	78.1 kDa
KinaseFamily	DDR Kinase Family
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human DDR1, GST Tag
Accession Number	Q08345
Gene Alias	6030432F18; AI323681; Cak; CD167; CD167 antigen-like family member A; CD167a; Cell adhesion kinase; DAAP-278B20.1; DDR; DDR1; DDR1d; discoidin domain receptor family, member 1; discoidin domain receptor tyrosine kinase 1; discoidin receptor tyrosine kinase; Drd1; Eddr1; Epithelial discoidin domain receptor 1; epithelial discoidin domain-containing receptor 1; HGK2; mammary carcinoma kinase 10; MCK10; MCK-10; Mpk6; NEP; neuroepithelial tyrosine kinase; neurotrophic tyrosine kinase receptor type 4; neurotrophic tyrosine kinase, receptor, type 4; NTRK4; protein-tyrosine kinase 3; Protein-tyrosine kinase 3 A; Protein-tyrosine kinase MPK-6; protein-tyrosine kinase PTK-3; protein-tyrosine kinase RTK-6; PTK3; PTK3A; PTK3A protein tyrosine kinase 3 A; PTK3D; RTK6; TRK E; TRKE; Tyrosine kinase DDR; tyrosine-protein kinase CAK
Protein Length	440-876
Gene ID (Entrez)	780
Formulation	proprietary buffer with no preservative
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

786

Invitrogen™ PXR (SXR) Ligand Binding Domain Protein, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Formulation	proprietary buffer with no preservative
Concentration	See Label
For Use With (Application)	Ligand Binding Assay
Name	PXR (SXR) Ligand Binding Domain Protein, GST Tag
Recombinant	Recombinant

787

Invitrogen™ Human NLK, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	84.5 kDa
Formulation	50 mM tris HCl with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human NLK, GST Tag
Recombinant	Recombinant

788

Invitrogen™ Human RIPK5, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	132.7 kDa
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human RIPK5, GST Tag
Recombinant	Recombinant

789

Invitrogen™ Human JAK2 [V617F], JH1 and JH2 Domains, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	97.9 kDa
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human JAK2 [V617F], JH1 and JH2 Domains, GST Tag
Recombinant	Recombinant

790

Invitrogen™ Human CAMKK2 (CaMKK Beta), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	CAMKK2
Molecular Weight (g/mol)	87.1 kDa
KinaseFamily	CAMKK Kinase Family
Sequence	Full length
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human CAMKK2 (CaMKK Beta), GST Tag
Accession Number	Q96RR4
Gene Alias	6330570N16Rik; AW061083; Ca+/Calmodulin-dependent protein kinase kinase beta (CaM-kinase kinase beta); calcium/calmodulin dependent protein kinase kinase 2; calcium/calmodulin-dependent protein kinase 2 beta; calcium/calmodulin-dependent protein kinase beta; calcium/calmodulin-dependent protein kinase kinase 2; calcium/calmodulin-dependent protein kinase kinase 2, beta; calcium/calmodulin-dependent protein kinase kinase beta; caM-kinase kinase 2; CaM-kinase kinase beta; CAMKK; caMKK 2; caM-KK 2; caMKK beta; CaM-KK beta; CAMKK beta protein; CAMKK2; CAMKKB; KIAA0787; MGC15254; mKIAA0787
Gene ID (Entrez)	10645
Formulation	50 mM tris HCl with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

791

Invitrogen™ Human LXR-a, Ligand Binding Domain, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Formulation	proprietary buffer with no preservative
Concentration	See Label
For Use With (Application)	Ligand Binding Assay
Name	Human LXR-a, Ligand Binding Domain, GST Tag
Recombinant	Recombinant

792

Invitrogen™ Human AMPK alpha-2/beta-2/gamma-1, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	AMPK alpha-2/beta-2/gamma-1
Molecular Weight (g/mol)	63.1-36-40 kDa
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human AMPK alpha-2/beta-2/gamma-1, His Tag
Protein Length	1-552, 1-272, 1-331
Formulation	50 mM sodium phosphate with 0.1 mM PMSF, 0.2 mM DTT, 150 mM Imidazole, 25% glycerol, 300 mM NaCl and no preservative; pH 7
Protein Tag	His-tag
Species	Human
Recombinant	Recombinant

793

Invitrogen™ Human CF106 (aa 80-151) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	DVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPSR
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human CF106 (aa 80-151) Control Fragment
Recombinant	Recombinant

794

Invitrogen™ Human DCAMKL2 (DCK2), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	103.6 kDa
Formulation	50 mM tris HCl with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human DCAMKL2 (DCK2), GST Tag
Recombinant	Recombinant

795

Invitrogen™ Human PIK3CG (p110 gamma), His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	PIK3CG
Molecular Weight (g/mol)	130.5 kDa
KinaseFamily	PI3 Kinase Family
Sequence	Full length
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human PIK3CG (p110 gamma), His Tag
Accession Number	P48736
Gene Alias	1-phosphatidylinositol 3-kinase; 5830428L06Rik; EGK_14026; p110gamma; p110-gamma; p120-PI3K; phosphatidylinositol 3 kinase gamma, p110 gamma; phosphatidylinositol 3-kinase catalytic 110-kD gamma; phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma; Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform; phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform; phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma; Phosphoinositide-3-kinase catalytic gamma polypeptide; phosphoinositide-3-kinase gamma catalytic subunit; phosphoinositide-3-kinase, catalytic, gamma polypeptide; PI3CG; PI3K; pi3kcg; Pi3kg1; PI3Kgamma; PI3K-gamma; PI3-kinase subunit gamma; PIK3; Pik3cg; ptdIns-3-kinase subunit gamma; ptdIns-3-kinase subunit p110-gamma; Serine/threonine protein kinase PIK3CG
Gene ID (Entrez)	5294
Formulation	50 mM tris HCl with 0.1 mM EGTA, 10% glycerol, 150 mM NaCl, 2 mM DTT and no preservative; pH 7.5
Protein Tag	His-tag
Species	Human
Recombinant	Recombinant

Prev
1
...
51
52
53
54
...
8,666
Next

Recombinant Proteins

Filtered Search Results

Narrow Results