Recombinant Proteins
- (285)
- (11)
- (65,867)
- (1)
- (2)
- (970)
- (1)
- (23,540)
- (5)
- (1)
- (1)
- (67)
- (216)
- (4,420)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,448)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (157)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (22,591)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,799)
- (253)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (105)
- (1)
- (3,750)
- (1,407)
- (3)
- (4)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (138)
- (48)
- (6)
- (17)
- (2)
- (1)
- (10)
- (4)
- (81)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,522)
- (2)
- (1)
- (160)
- (18)
- (48)
- (3)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (208)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,708)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,758)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (27,095)
- (235)
- (1)
- (3)
- (2)
- (1)
- (2)
- (1)
- (89)
- (559)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,303)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (29,092)
- (5)
- (22)
- (8)
- (4)
- (1,291)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (8)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (233)
- (9)
- (2)
- (5)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,574)
- (1)
- (48)
- (15)
- (1)
- (2)
- (45,208)
- (5,648)
- (245)
- (168)
- (56)
- (3,361)
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (3)
- (19)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (43,090)
- (1)
- (11)
Filtered Search Results
Novus Biologicals™ Recombinant Human RNASEH2A His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
Novus Biologicals™ NMRAL1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | NMRAL1 |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Source | Human |
Novus Biologicals™ PCDH11 Recombinant Protein Antigen
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
Novus Biologicals Recombinant Human alpha-Synuclein Oligomers, (Dopamine HCL Stabilized) Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
| Purity or Quality Grade | >95%, by SDS-PAGE |
|---|---|
| Gene Alias | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| Gene ID (Entrez) | 6622 |
| Formulation | PBS pH 7.4 |
| Gene Symbol | SNCA |
| Research Category | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Storage Requirements | Store at -80C. Avoid freeze-thaw cycles. |
| For Use With (Application) | In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Protein | alpha-Synuclein |
Novus Biologicals™ Ran Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Purity or Quality Grade | >90% |
|---|---|
| Conjugate | Unconjugated |
| Common Name | Ran |
| Molecular Weight (g/mol) | 26.5kDa |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1.0mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Recombinant human RAN, fused to His-tag at N-terminus, expressed in E. coli |
| Accession Number | NP_006316 |
| Regulatory Status | RUO |
| Purification Method | Protein |
| Gene ID (Entrez) | 5901 |
| Formulation | In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol |
| Immunogen | RAN, 1-216aa, Human, His tag, E. coli (NP_006316). |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Human SIRP alpha/CD172a Alexa Fluor™ 647 Protein
Fc Chimera
Novus Biologicals™ ECH1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | ECH1 |
| Molecular Weight (g/mol) | 34.4kDa |
| Formulation | Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 50mM NaCl |
| Immunogen | ECH1, 34-328aa. Sequence: MGSSHHHHHHSSGLVPRGSHMTGSSAQEAASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
R&D Systems™ Recombinant Human OSCAR Fc Chimera Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ Recombinant Human Fibrinogen beta chain His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Purity or Quality Grade | >85%, by SDS-PAGE |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | fibrinogen beta chain, fibrinogen, B beta polypeptide, MGC104327, MGC120405 |
| Common Name | Fibrinopeptide B |
| Molecular Weight (g/mol) | TMW: 40kDa |
| Gene ID (Entrez) | 2244 |
| Formulation | 20mM Tris-HCl buffer(pH8.0) containing 10% glycerol |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Porcine IL-2 (Cys146Ala) Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
| Purity or Quality Grade | 97%, by SDS-PAGE under reducing conditions and visualized by silver stain. |
|---|---|
| Conjugate | Unconjugated |
| Molecular Weight (g/mol) | 15.3 kDa |
| Gene ID (Entrez) | 396868 |
| Quantity | 20 μg |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution. |
| Source | E. coli-derived porcine IL-2 protein Ala21-Thr154 (Cys146Ala),with an N-terminal Met |
| Recombinant | Recombinant |
| Name | IL-2 (Cys146Ala) |
Novus Biologicals™ PPP1R16B Recombinant Protein Antigen
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
R&D Systems™ Recombinant Mouse Plasma Kallikrein/KLKB1 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity
R&D Systems™ Recombinant MERS-CoV Nucleocapsid His-tag Protein
Sf21 Insect Cell Expressed, Over 95% Purity
Novus Biologicals™ PGLS Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | PGLS |
| Molecular Weight (g/mol) | 29.7kDa |
| Gene ID (Entrez) | 25796 |
| Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 100mM NaCl |
| Immunogen | PGLS, 1- 258 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMAAPAPGLISVFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLARELPAAVAPAGPASLARWTLGFCDERLVPFDHAESTYGLYRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPKPPPQRVTLTLPVLNAARTVIFVATGEGKAAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |