Recombinant Proteins
- (2)
- (59)
- (25)
- (1)
- (78)
- (2)
- (1)
- (1)
- (2)
- (3)
- (2)
- (51)
- (89)
- (33)
- (52)
- (84)
- (29)
- (2)
Filtered Search Results
Novus Biologicals™ Recombinant Human GMPS His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
ProSci GMP Reductase 1 Recombinant Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
| Molecular Weight (g/mol) | 38.5 kDa |
|---|---|
| Species | Human |
| Source | Human Cells |
Invitrogen™ Human GMPS (aa 13-152) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | AGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLT |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human GMPS (aa 13-152) Control Fragment |
| Recombinant | Recombinant |
Gibco™ PeproGMP™ Human IL-7 Recombinant Protein, PeproTech®
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
|---|---|
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Common Name | IL-7 |
| Molecular Weight (g/mol) | 17.4 kDa |
| Gene Symbol | Il7, IL7r |
| Activity | Determined by the proliferation of mouse 2E8 cells. PeproGMP Recombinant Human IL-7 has been tested against the WHO standard NIBSC 90/530. Find the International Unit (IU) value <a href='https://www.thermofisher.com/us/en/home/life-science/cell-culture/cell-culture-learning-center/recombinant-protein-information/international-units.html'>here</a>. |
| Endotoxin Concentration | ≤0.1 EU/μg |
| Sequence | DCDIEGKDGK QYESVLMVSI DQLLDSMKEI GSNCLNNEFN FFKRHICDAN KEGMFLFRAA RKLRQFLKMN STGDFDLHLL KVSEGTTILL NCTGQVKGRK PAALGEAQPT KSLEENKSLK EQKKLNDLCF LKRLLQEIKT CWNKILMGTK EH |
| Storage Requirements | -20°C or -80°C if preferred |
| Expression System | E. coli |
| For Use With (Application) | Control,Western Blot Control,Bioactivity |
| Name | PeproGMP™ Human IL-7 |
| Accession Number | P13232, P16871 |
| Regulatory Status | GMP |
| Purification Method | Purified |
| Gene Alias | A630026I06Rik; H-IL-7; hlb368; IL7; Il-7; ILN; Interleukin; interleukin 7; Interleukin7; interleukin-7; M-IL-7 |
| Product Type | Protein |
| Gene ID (Entrez) | 3574, 3575 |
| Formulation | Protein with no preservative |
| Recombinant | Recombinant |
Gibco™ PeproGMP™ Human IL-6 Recombinant Protein, PeproTech®
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
|---|---|
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Common Name | IL-6 |
| Molecular Weight (g/mol) | 20.9 kDa |
| Gene Symbol | Il6 |
| Activity | Determined by the proliferation of mouse 7TD1 cells. PeproGMP Recombinant Human IL-6 has been tested against the WHO standard NIBSC 89/548. Find the International Unit (IU) value <a href='https://www.thermofisher.com/us/en/home/life-science/cell-culture/cell-culture-learning-center/recombinant-protein-information/international-units.html'>here</a>. |
| Endotoxin Concentration | ≤0.1 EU/μg |
| Sequence | PVPPGEDSKD VAAPHRQPLT SSERIDKQIR YILDGISALR KETCNKSNMC ESSKEALAEN NLNLPKMAEK DGCFQSGFNE ETCLVKIITG LLEFEVYLEY LQNRFESSEE QARAVQMSTK VLIQFLQKKA KNLDAITTPD PTTNASLLTK LQAQNQWLQD MTTHLILRSF KEFLQSSLRA LRQM |
| Storage Requirements | -20°C or -80°C if preferred |
| Expression System | E. coli |
| For Use With (Application) | Control,Western Blot Control,Bioactivity |
| Name | PeproGMP™ Human IL-6 |
| Accession Number | P05231 |
| Regulatory Status | GMP |
| Purification Method | Purified |
| Gene Alias | B-cell differentiation factor; B-cell hybridoma growth factor; B-cell stimulatory factor 2; BSF2; BSF-2; CDF; CHIL-6; CTL differentiation factor; cytokine; HGF; H-IL-6; HSF; hybridoma growth factor; Ifnb2; IFN-beta-2; Il6; IL-6; ILg6; ILN; interferon beta-2; Interleukin; interleukin 6; Interleukin 6 (interferon, beta 2); interleukin 6 precursor; interleukin BSF-2; interleukin HP-1; Interleukin6; Interleukin-6; interleukin-6 precursor; interleukin-6 protein; M-IL-6; prointerleukin 6; R-IL-6 |
| Product Type | Protein |
| Gene ID (Entrez) | 3569 |
| Formulation | Protein with no preservative |
| Recombinant | Recombinant |
Gibco™ PeproGMP™ Human TPO (Thrombopoietin) Recombinant Protein, PeproTech®
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
|---|---|
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Common Name | Thrombopoietin |
| Molecular Weight (g/mol) | 18.6 kDa |
| Gene Symbol | THPO |
| Activity | Determined by its ability to stimulate human MO7e cell proliferation. PeproGMP Recombinant HumanTPO has been tested against the WHO standard NIBSC 03/124. Find the International Unit (IU) value <a href='https://www.thermofisher.com/us/en/home/life-science/cell-culture/cell-culture-learning-center/recombinant-protein-information/international-units.html'>here</a>. |
| Endotoxin Concentration | ≤0.1 EU/μg |
| Sequence | SPAPPACDLR VLSKLLRDSH VLHSRLSQCP EVHPLPTPVL LPAVDFSLGE WKTQMEETKA QDILGAVTLL LEGVMAARGQ LGPTCLSSLL GQLSGQVRLL LGALQSLLGT QLPPQGRTTA HKDPNAIFLS FQHLLRGKVR FLMLVGGSTL CVRRAPPTTA VPSRTSLVLT LNEL |
| Storage Requirements | -20°C or -80°C if preferred |
| Expression System | E. coli |
| For Use With (Application) | Control,Western Blot Control,Bioactivity |
| Name | PeproGMP™ Human TPO (Thrombopoietin) |
| Accession Number | P40225 |
| Regulatory Status | GMP |
| Purification Method | Purified |
| Gene Alias | C-mpl ligand; Megakaryocyte colony-stimulating factor; megakaryocyte growth and development factor; megakaryocyte stimulating factor; Mgdf; MKCSF; ML; MPL ligand; Mpllg; MSA; Myeloproliferative leukemia virus oncogene ligand; prepro-thrombopoietin; TDH2A; THCYT1; THPO; Thrombopoietin; thyroid microsomal antigen; thyroid peroxidase; thyroperoxidase; Tpo; TPX |
| Product Type | Protein |
| Gene ID (Entrez) | 7066 |
| Formulation | Protein with no preservative |
| Recombinant | Recombinant |
Gibco™ PeproGMP™ Human BDNF Recombinant Protein, PeproTech®
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
|---|---|
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Molecular Weight (g/mol) | 13.5(monomer) kDa |
| Common Name | BDNF |
| Gene Symbol | BDNF |
| Activity | Determined by the proliferation of rat C6 cells. |
| Endotoxin Concentration | ≤0.1 EU/μg |
| Storage Requirements | -20°C |
| Sequence | HSDPARRGEL SVCDSISEWV TAADKKTAVD MSGGTVTVLE KVPVSKGQLK QYFYETKCNM GYTKEGCRGI DKRHWNSQCR TTQSYVRALT MDSKKRIGWR FIRIDTSCVC TLTIKRGR |
| Expression System | E. coli |
| For Use With (Application) | Control,Western Blot Control,Bioactivity |
| Name | PeproGMP™ Human BDNF |
| Accession Number | P23560 |
| Regulatory Status | GMP |
| Purification Method | Purified |
| Gene Alias | abrineurin; ANON2; anorexia BDNF; Bdnf; BDNF precursor form; bdnf protein; brain derived neurothrophic factor; brain derived neurotrophic factor; brain-derived neurotrophic factor; BULN2; H-BDNF; neurotrophin; ProBDNF |
| Product Type | Protein |
| Gene ID (Entrez) | 627 |
| Formulation | Protein with no preservative |
| Recombinant | Recombinant |
| Accession Number | P13232.1 |
|---|---|
| Purity or Quality Grade | >97%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining. |
| Conjugate | Unconjugated |
| Gene Alias | IL7, IL-7 interleukin-7, interleukin 7, Lymphopoietin-1, PBGF |
| Molecular Weight (g/mol) | M.W.-observed: 17 kDa, under reducing conditions., M.W.-theroretical: 17 kDa |
| Gene ID (Entrez) | 3574 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. |
| Reconstitution | Reconstitute at 100-500 μg/mL in PBS. |
| Endotoxin Concentration | <0.10 EU / 1 μg of the protein by the LAL method. |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution. |
| For Use With (Application) | Bioactivity |
| Protein | IL-7 |
| Source | E. coli-derived human IL-7 protein Asp26-His177, with an N-terminal Met |
Gibco™ CTS™ HiFi Cas9 Protein
Gibco CTS HiFi Cas9 Protein is our GMP-manufactured high-fidelity CRISPR-Cas9 protein, engineered to deliver reduced off-target effects while maintaining high on-target activity.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Shipping Condition | Dry Ice |
|---|---|
| Content And Storage | Store at –20°C. |
| Form | Liquid |
| Product Type | Cas9 Protein |
| Manufacturing Quality | ISO 13485 |
| Research Category | Genome Editing |
| Shelf Life | 18 months from date of manufacture |
| Concentration | 10 mg/mL |
| Expression System | E. coli |
Gibco™ CTS™ HiFi Cas9 Protein and CTS™ Xenon Genome Editing Buffer Kit
This kit includes CTS HiFi Cas9 Protein and CTS Xenon Genome Editing Buffer (also available separately).
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Shipping Condition | Dry Ice |
|---|---|
| Form | Liquid |
| Product Type | Cas9 Protein and Buffer kit |
| Manufacturing Quality | ISO 13485 |
| Research Category | Genome Editing |
| Shelf Life | 18 months from date of manufacture |
| Concentration | 10 mg/mL |
| Expression System | E. coli |
| Accession Number | P13232.1 |
|---|---|
| Purity or Quality Grade | >97%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining. |
| Conjugate | Unconjugated |
| Gene Alias | IL7, IL-7 interleukin-7, interleukin 7, Lymphopoietin-1, PBGF |
| Gene ID (Entrez) | 3574 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. |
| Reconstitution | Reconstitute at 100 - 500 μg/mL in PBS. |
| Endotoxin Concentration | <0.10 EU / 1 μg of the protein by the LAL method. |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution. |
| For Use With (Application) | Bioactivity |
| Protein | IL-7 |
| Source | E. coli-derived human IL-7 protein Asp26-His177, with an N-terminal Met Produced using non-animal reagents in an animal-free laboratory. |
R&D Systems™ Recombinant Human Guanylate Kinase Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Gibco™ CTS™ TrueCut™ Cas9 Protein
Gibco™ CTS TrueCut Cas9 Protein is our highest performing CRISPR-Cas9 protein, engineered to deliver maximum ribonucleoprotein (RNP)-editing efficiency.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Shipping Condition | Dry Ice |
|---|---|
| Content And Storage | Store at –20°C. |
| Form | Liquid |
| Product Type | Cas9 Protein |
| Manufacturing Quality | ISO13485 |
| Research Category | Genome Editing |
| Shelf Life | 36 months from date of manufacture |
| Concentration | 10 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Cell and Gene Therapy Research, Development, and Manufacturing |
| Sterility | Sterile-filtered |
Novus Biologicals™ Recombinant Human PDE6H His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Purity or Quality Grade | >80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | EC 3.1.4.17, EC 3.1.4.35, GMP-PDE gamma, phosphodiesterase 6H, cGMP-specific, cone, gamma, RCD3, retinal cone rhodopsin-sensitive cGMP 3'-5'-cyclic phosphodiesterase subunitgamma |
| Common Name | PDE6H |
| Molecular Weight (g/mol) | TMW: 11.5kDa |
| Gene ID (Entrez) | 5149 |
| Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 40% glycerol, 2mM DTT, 0.1mM PMSF |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
Invitrogen™ Human GMPR (aa 56-135) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | DTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYS |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human GMPR (aa 56-135) Control Fragment |
| Recombinant | Recombinant |