Organic Acids
![Medchemexpress LLC L-Prolinamide, N,N-bis(phenylmethyl)glycyl]-4-[4-[[4-[[(phenylmethyl)amino]phosphonomethyl] | 99.9% | 1323.35 | 1 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000386801-logo.png-250.jpg){kind=logo}
Medchemexpress LLC L-Prolinamide, N,N-bis(phenylmethyl)glycyl]-4-[4-[[4-[[(phenylmethyl)amino]phosphonomethyl] | 99.9% | 1323.35 | 1 MG
OncoACP3 TFA from MedChemExpress is a small-molecule ligand of prostatic acid phosphatase (ACP3). This product is applicable to research related to prostate cancer.
- Molecular formula: C62H82F3N12O15P
- Molecular weight: 1323.35
- Appearance: White to off-white solid
- Storage: Powder at -20°C for 3 years; in solvent at -80°C for 6 months, or -20°C for 1 month
- Purity (LCMS): 99.87%
Medchemexpress LLC LL-37, human TFA | 154947-66-7 | 100.0% | 4493.26 | 5 MG
LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide. It demonstrates a broad spectrum of antimicrobial activity.
- Exhibits broad-spectrum antimicrobial activity.
- May help protect the cornea from infection.
- Modulates wound healing.
Medchemexpress LLC Z-VRPR-FMK TFA | 1926163-57-6 | MFCD18782585 | 95.9% | 790.81 | 100 UG
Z-VRPR-FMK (TFA) (VRPR), a tetrapeptide, is a selective and irreversible MALT1 (Mucosa-associated lymphoid tissue lymphoma translocation protein 1) inhibitor. It can protect against influenza A virus (IAV) infection.
- Selective and irreversible MALT1 inhibitor
- Tetrapeptide
- Protects against influenza A virus (IAV) infection
Medchemexpress LLC Astressin 2B TFA | 99.54% | 4041.69 | 500 UG
Astressin 2B TFA is a blood-brain barrier-impermeable, highly selective CRFR2 antagonist. It blocks the protective effects mediated by CRFR2, thereby exacerbating indomethacin-induced hemorrhagic intestinal injury in rats. It also reverses the protective effects of Urocortin 1 and attenuates stress-induced anxiety-related behaviors. This product is a valuable tool for investigating the intestinal protective mechanisms of CRFR2.
- Highly selective CRFR2 antagonist (IC50=0.57 nM).
- Blood-brain barrier-impermeable.
- Exacerbates indomethacin-induced hemorrhagic intestinal injury.
- Reverses protective effects of urocortin 1.
- Attenuates stress-induced anxiety-related behaviors.
- Valuable tool for studying CRFR2 intestinal protective mechanisms.
Medchemexpress LLC D-GsMTx4 TFA | 99.89% | 4095.84 | 2 MG
D-GsMTx4 TFA is a spider peptide and the D enantiomer of GsMTx4. It inhibits the mechanosensitive ion channel Piezo2, [Ca2+]i elevation, and mTOR and PI3K-Akt signaling pathways. This peptide can be used in research related to mechanical stress, chronic pain, and idiopathic pulmonary fibrosis.
- Inhibits Piezo2-mediated mechanosensitive inward currents
- Decreases phosphorylation levels in mTOR and PI3K-Akt signaling pathways
- Inhibits mechanical stimulation-evoked [Ca2+]i increases
- Significantly inhibits mechanical allodynia and thermal hyperalgesia
Medchemexpress LLC 5-FAM-LL-37 TFA | 95.76% | 4851.56 (free acid) | 1 MG
5-FAM-LL-37 TFA is the TFA salt form of 5-FAM-LL-37, a LL-37 peptide labeled with fluorescein. It retains the antibacterial and immunomodulatory activities of LL-37 by binding to the bacterial cell membrane, thereby destroying its integrity and demonstrating broad-spectrum antibacterial efficacy.
- Retains antibacterial and immunomodulatory activities
- Binds to bacterial cell membrane
- Demonstrates broad-spectrum antibacterial efficacy
Medchemexpress LLC G-Pen-GRGDSPCA (TFA) | 98.8% | 948.04 | 5 MG
G-Pen-GRGDSPCA (TFA) is a solid, white to off-white chemical product primarily identified for use as a laboratory chemical and in the manufacture of substances. It demonstrates stability under recommended storage conditions.
- Appearance: white to off-white solid
- Chemical stability: stable under recommended storage conditions
- Identified uses: laboratory chemicals, manufacture of substances
- Purity: 98.76% (LCMS)
- Consistent with structure (LCMS)
Medchemexpress LLC G7-18NATE TFA | 98.1% | 1417.5 | 5 MG
G7-18NATE TFA is a peptide inhibitor of Grb7. It binds to the Grb7-SH2 domain with micromolar affinity (Kd = 18.1 μM). G7-18NATE TFA inhibits cell proliferation, motility, cell invasion, and 3D culture formation in several cancer cell lines. For research use only, not sold to patients.
- Peptide inhibitor of Grb7.
- Binds to the Grb7-SH2 domain with micromolar affinity (Kd = 18.1 μM).
- Inhibits cell proliferation, motility, cell invasion, and 3D culture formation in several cancer cell lines.
- Purity: 98.1%.
Medchemexpress LLC aStAx-35R TFA | 99.1% | 2392.86 | 1 MG
aStAx-35R TFA is a stapled peptide that functions as an antagonist of the nuclear form of β-catenin, thereby inhibiting Wnt signaling. It competitively prevents the binding of β-catenin to TCF4 and selectively induces growth inhibition in Wnt-dependent cancer cells.
- Directly targets and antagonizes the nuclear form of β-catenin.
- Effectively inhibits the Wnt signaling pathway.
- Competitively inhibits the binding of β-catenin to TCF4.
- Selectively induces growth inhibition in cancer cells dependent on Wnt signaling.
Medchemexpress LLC (RXR)4XB TFA | 96.6% | 1904.37 | 1 MG
(RXR)4XB TFA is a cell-penetrating peptide that binds phosphorodiamidate morpholino oligomers (PMOs), forming peptide-conjugated PMOs (PPMOs), and enhances the delivery of PMO into bacterial cells. The (RXR)4XB TFA-PMO conjugate is effective in preventing biofilm formation, inhibiting *Pseudomonas aeruginosa* with an MIC50 of 0.5 to 16 μM, and reducing bacterial burden in mouse acute pneumonia models.
- Forms peptide-conjugated PMOs (PPMOs)
- Enhances delivery of PMO into bacterial cells
- Prevents biofilm formation
- Inhibits *Pseudomonas aeruginosa*
- Reduces bacterial burden in mouse acute pneumonia models
Medchemexpress LLC Pardaxin P5 TFA | 67995-63-5 | ≥98% | 3381.87 | 1 MG
Pardaxin P5 TFA is the trifluoroacetate salt form of Pardaxin P5. This antimicrobial peptide is known to inhibit Escherichia coli with a MIC value of 13 μM, making it suitable for anti-infection research.
- Antimicrobial peptide
- Inhibits Escherichia coli with a MIC value of 13 μM
- TFA salt form of Pardaxin P5
- Supplied as a solid
- Specific peptide sequence: GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE
- Soluble in DMSO (100 mg/mL, requires ultrasonic)
- Targets bacterial organisms and anti-infection pathways
Medchemexpress LLC OS-2966 1mg | 1mg
OS-2966 is a humanized antibody expressed in CHO cells targeting Integrin b1/ITGB1/CD29 OS-2966 carries a huIgG1 type heavy chain and a hu type light chain with a predicted molecular weight (MW) of 145 5 kDa The isotype control for OS-2966 can be referenced as Human IgG1 kappa Isotype Control (HY-P99001)
Medchemexpress LLC Pgk13a TFA | 96.9% | 2004.73 (free base) | 5 MG
pGk13a TFA is an azide-containing amphiphilic membrane labeling probe. It enables high-resolution imaging of cell membranes in the ultrastructural membrane expansion microscopy (umExM) technique, facilitating the observation of membrane-associated structures and proteins. It can be used for neuronal structural studies.
- Azide-containing amphiphilic membrane labeling probe
- Enables high-resolution imaging of cell membranes
- Used in ultrastructural membrane expansion microscopy (umExM)
- Facilitates observation of membrane-associated structures and proteins
- Applicable for neuronal structural studies
Medchemexpress LLC TAM557 TFA | 98.5% | 1119.34 | 1 MG
TAM557 TFA is a cytotoxic tubulysin compound designed for conjugation to transport vehicles such as proteins, peptides, small molecules, or polymeric carriers that incorporate a targeting principle. It is intended for research use only.
- Cytotoxic tubulysin compound
- Modified for conjugation to transport vehicles
- Appearance: solid, white to off-white
- Shipping at room temperature
- Store at -20°C, sealed, away from moisture and light
- In solvent, store at -80°C for 6 months or -20°C for 1 month
Medchemexpress LLC XStAx-VHLL TFA | 99.9% | 3231.89 | 1 MG
xStAx-VHLL TFA is a β-catenin PROTAC degrader that promotes ubiquitination and proteasome degradation of β-catenin. It inhibits the Wnt/β-catenin signaling pathway, can inhibit the proliferation of colon cancer cells, and has anti-tumor activity.
- Promotes ubiquitination and proteasome degradation of β-catenin.
- Inhibits the Wnt/β-catenin signaling pathway.
- Inhibits the proliferation of colon cancer cells.
- Exhibits anti-tumor activity in mouse intestinal tumor models.
- Induces β-catenin degradation and inhibits cell proliferation in colorectal cancer cells.
- Inhibits Wnt/β-catenin signaling in HEK293T cells.