Cresols
Medchemexpress LLC P-Selectin Rhesus M 100ug
P-Selectin Protein Rhesus Macaque (HEK293 His) is a member of the selectin family of cell adhesion molecules P-selectin (CD62P) has an N-terminal lectin domain an epidermal growth factor motif (generally) nine regulatory protein repeats a transmembrane section and a short intracytoplasmic tail P-selectin mediates leukocyte rolling on stimulated endothelial cells and heterotypic aggregation of activated platelets onto leukocytes P-selectin mediates heterotypic aggregation of activated platelets to cancer cells and adhesion of cancer cells to stimulated endothelial cells P-selectin glycoprotein ligand-1 (PSGL-1) is a major ligand for P-selectin[1][2][3] P-Selectin Protein Rhesus Macaque (HEK293 His) is the recombinant Rhesus Macaque-derived P-Selectin protein expressed by HEK293 with C-His labeled tag
Medchemexpress LLC Methyl p-coumarate | 3943-97-3 | 178.18 | 5 G
Methyl p-coumarate | 3943-97-3 | 178.18 | 5 G
Medchemexpress LLC 3-(2-Pyridyldithio)propanoic acid | 68617-64-1 | 99.5% | 1 G
3-(2-Pyridyldithio)propanoic acid is an alkyl chain-based PROTAC linker designed for use in the synthesis of PROTACs. PROTACs are molecules that contain two different ligands connected by a linker, utilizing the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
- Alkyl chain-based PROTAC linker
- Used in the synthesis of PROTACs
- For research use only
Medchemexpress LLC C-Type Natriuretic Peptide (1-53), human TFA | 141294-77-1 | 99.94% | 5801.77 | 10 MG
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. This natriuretic peptide family peptide is involved in the maintenance of electrolyte-fluid balance and vascular tone.
- Molecular formula: C251H417N81O71S3.xC2HF3O2
- Appearance: Solid
- Color: White to off-white
- Sequence (shortened): DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)
- Solubility: H2O: 50 mg/mL (ultrasonic needed)
- Target: Angiotensin receptor
- Pathway: GPCR/G protein
Medchemexpress LLC Camptothecin-20S-O-p 25mg | 194414-69-2 | 25 MG
Camptothecin-20(S)-O-propionate (CZ48) is the C20-propionate ester of camptothecin that functions as a topoisomerase I inhibitor and has reported antitumor activity in animal models. It is provided as a solid and as prepared solutions for research use, with recommended storage to maintain stability.
- Acts as a topoisomerase I inhibitor
- Demonstrated antitumor activity in breast and prostate carcinoma models
- Available as solid and 10 mM DMSO solution formulations
- High purity suitable for research (reported ~99.5%)
- Stable under recommended storage: powder -20°C for long term, solvent -80°C
Aobchem (6-Chloro-2-fluoro-3-methylphenyl)(p-tolyl)methanol | 97% | CAS 3002476-95-8 | C15H14ClFO | 1g
(6-Chloro-2-fluoro-3-methylphenyl)(p-tolyl)methanol | 97% | CAS 3002476-95-8 | C15H14ClFO | 1g
Aobchem (6-Chloro-2-fluoro-3-methylphenyl)triethylsilane | 97% | CAS 3002543-68-9 | C13H20ClFSi | 1g
(6-Chloro-2-fluoro-3-methylphenyl)triethylsilane | 97% | CAS 3002543-68-9 | C13H20ClFSi | 1g
Medchemexpress LLC PfLDH P. falciparum 500ug | 500ug
The pfHPRT (Plasmodium falciparum hypoxanthine-guanine phosphoribosyltransferase) protein is a member of the LDH/MDH (lactate dehydrogenase/malate dehydrogenase) superfamily It plays a crucial role in the purine metabolism salvage pathway of the malaria-causing parasite Plasmodium falciparum PfLDH Protein P falciparum (His) is the recombinant PfLDH protein expressed by E coli with C-His labeled tag
Cambridge Isotope Laboratories 1 2 3 4 7 8-Hexabromodibenzo-p-dioxin (unlabeled) 5 ug/mL in nonane toluene (70 30) 1 2 mL
1 2 3 4 7 8-Hexabromodibenzo-p-dioxin (unlabeled) 5 ug/mL in nonane toluene (70 30) 1 2 mL
Medchemexpress LLC N-(p-Coumaroyl) Serotonin | 68573-24-0 | 99.0% | 25 MG
N-(p-Coumaroyl) Serotonin is a selective inhibitor of PDGFRβ, ERK1/2, and caspase-8 with antioxidant, anti-atherosclerotic, and anti-inflammatory properties. It inhibits glioblastoma cells (U251MG, T98G) and normal fibroblasts. This compound inhibits PDGF signaling by reducing receptor phosphorylation, blocks Ca2+ influx, and induces apoptosis by activating caspase-8. It may improve atherosclerosis and aortic wall enlargement, and is also used in the study of glioblastoma.
- Selective inhibitor of PDGFRβ, ERK1/2, and caspase-8
- Possesses antioxidant, anti-atherosclerotic, and anti-inflammatory properties
- Inhibits glioblastoma cell growth
- Inhibits PDGF signaling by reducing receptor phosphorylation
- Blocks Ca2+ influx and induces apoptosis
- May improve atherosclerosis and aortic wall enlargement
Aobchem (5-Ethoxy-2-fluoro-3-methylphenyl)(methyl)sulfane | ≥97% | CAS 2635937-77-6 | C10H13FOS | 1g
(5-Ethoxy-2-fluoro-3-methylphenyl)(methyl)sulfane | ≥97% | CAS 2635937-77-6 | C10H13FOS | 1g
Aobchem 2-(3-(Trifluoromethyl)phenyl)propan-2-ol | ≥95% | CAS 618-11-1 | C10H11F3O | 500mg
2-(3-(Trifluoromethyl)phenyl)propan-2-ol | ≥95% | CAS 618-11-1 | C10H11F3O | 500mg
Aobchem 3-Fluoro-2-methoxy-4-methylphenol | ≥95% | CAS 2385327-41-1 | C8H9FO2 | 1g
3-Fluoro-2-methoxy-4-methylphenol | ≥95% | CAS 2385327-41-1 | C8H9FO2 | 1g
Aobchem 6-(P-tolyloxy)nicotinaldehyde | ≥95% | CAS 338960-65-9 | C13H11NO2 | 5g
6-(P-tolyloxy)nicotinaldehyde | ≥95% | CAS 338960-65-9 | C13H11NO2 | 5g