Whole Blood Cells
Kingfisher Biotech Inc Jamaican fruit-eating Bat IFN gamma Recombinant Protein
The Jamaican Fruit-eating Bat IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Jamaican Fruit-eating Bat IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. Jamaican Fruit-eating Bat IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Jamaican Fruit-eating Bat IFN gamma Specifications: (Molecular Weight: 16.6 kDa) (Amino Acid Sequence: TFTTEIENLK EYFNASMSDV ADNETLFSNV LKKWKDESDR KIFQSQIVSF YFKLFDSLKD NQSIQSSVEV IKEDLRVKFF NSSNSKMEDF KKLIQIPVND LKVQRKAINE LIRVMHELTP GSNLRKRRRS PKLFHARSAS K (141)) (Gene ID: n/a). For research use only. Made in the USA
Kingfisher Biotech Inc Mouse Prolactin Recombinant Protein
The Mouse Prolactin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse Prolactin applications are for cell culture, ELISA standard, and Western Blot Control. Mouse Prolactin yeast-derived recombinant protein can be purchased in multiple sizes. Mouse Prolactin Specifications: (Molecular Weight: 22.4 kDa) (Amino Acid Sequence: LPICSAGDCQ TSLRELFDRV VILSHYIHTL YTDMFIEFDK QYVQDREFMV KVINDCPTSS LATPEDKEQA LKVPPEVLLN LILSLVQSSS DPLFQLITGV GGIQEAPEYI LSRAKEIEEQ NKQLLEGVEK IISQAYPEAK GNGIYFVWSQ LPSLQGVDEE SKILSLRNTI RCLRRDSHKV DNFLKVLRCQ IAHQNNC (197)) (Gene ID: 19109). For research use only. Made in the USA
Kingfisher Biotech Inc Dolphin TIM-3 Recombinant Protein
The Dolphin TIM-3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Dolphin TIM-3 applications are for cell culture, ELISA standard, and Western Blot Control. Dolphin TIM-3 yeast-derived recombinant protein can be purchased in multiple sizes. Dolphin TIM-3 Specifications: (Molecular Weight: 18.6 kDa) (Amino Acid Sequence: VYVSEVGQDA DLPCAYSPPT PEDLVPVCWG KGPCPLFQCH SLVLSTDGRN LSYWTSSRYL LKRNFRKGDV TLTIKNVTLE DSGTYCCRIQ FPGLMNDQKS NLELVIKPAK VTPAGTPWRD ITAAFPRMLT TEGPGSETQT LETLHDKNQT EISTLANELQ DMGATTRI (168)) (Gene ID: 101331594). For research use only. Made in the USA
Kingfisher Biotech Inc Equine CCL8 Recombinant Protein
The Equine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Equine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDAVSIPVT CCFGVVKKKV PIQRLESYTR ITSSQCSQEA VIFKTKVDKE ICADPKQKWV QDTMKRLDQR SQTPK (75)) (Gene ID: 100033927). For research use only. Made in the USA
Kingfisher Biotech Inc Feline IL-36RA Recombinant Protein
The Feline IL-36 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-36 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-36 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-36 Receptor Antagonist Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence VLSGALCFRM KDAELKVLYL HDNQLLAGRL HAGNIIQGEE ISVVPNRSLD AKLSPVILGV QGGSQCLSCG TGQEPTLKLE PVNIMELYLG AKESKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLSEDAS WDSPITDFYF QQCD (154)) (Gene ID: 101097230). For research use only. Made in the USA
Kingfisher Biotech Inc Mouse CCL6 Recombinant Protein
The Mouse CCL6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse CCL6 applications are for cell culture, ELISA standard, and Western Blot Control. Mouse CCL6 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse CCL6 Specifications: (Molecular Weight: 10.7 kDa) (Amino Acid Sequence: GLIQEMEKED RRYNPPIIHQ GFQDTSSDCC FSYATQIPCK RFIYYFPTSG GCIKPGIIFI SRRGTQVCAD PSDRRVQRCL STLKQGPRSG NKVIA (95)) (Gene ID: 20305). For research use only. Made in the USA
Kingfisher Biotech Inc Cynomolgus Monkey IL-21 Recombinant Protein
The Cynomolgus Monkey IL-21 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey IL-21 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey IL-21 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey IL-21 Specifications: (Molecular Weight: 16.0 kDa) (Amino Acid Sequence: HKSSSQGQDR HMIRMRQLID IVDQLKNYVN DLDPEFLPAP EDVETNCEWS AISCFQKAQL KSANTGNNER IINLSIKKLK RKSPSTGAER RQKHRLTCPS CDSYEKKPPK EFLERFKSLL QKMIHQHLSS RTHGSEDS (138)) (Gene ID: 102130762). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine CCL8 Recombinant Protein
The Bovine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDSVSTPITCCFSVINGKIPFKKLDSYTRITNSQCPQEAVIFKTKADRDVCADPKQKWVQTSIRLLDQKSRTPKP (76)) (Gene ID: 281044). For research use only. Made in the USA
Kingfisher Biotech Inc Egyptian Rousette Bat CCL8 Recombinant Protein
The Egyptian Rousette Bat CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat CCL8 Specifications: (Molecular Weight: 8.8 kDa) (Amino Acid Sequence: QPDSVSIPVT CCYNVIDIKI HIRKLKSYTR VTNSHCPQEA VIFKTKMDKE ICADPKEKWV QDSMKHLDKK SQTLKP (76)) (Gene ID: 107519945). For research use only. Made in the USA
Kingfisher Biotech Inc Feline IL-13 Recombinant Protein
The Feline IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-13 Specifications: (Molecular Weight: 12.7 kDa) (Amino Acid Sequence: SPGPHSRREL KELIEELVNI TQNQVSLCNG SMVWSVNLTT GMQYCAALES LINVSDCTAI QRTQRMLKAL CTQKPSAGQT ASERSRDTKI EVIQLVKNLL NHLRRNFRHG NFK (113)) (Gene ID: 101084678). For research use only. Made in the USA
Kingfisher Biotech Inc Rat Prolactin Receptor Recombinant Protein
The Rat Prolactin Receptor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat Prolactin Receptor applications are for cell culture, ELISA standard, and Western Blot Control. Rat Prolactin Receptor yeast-derived recombinant protein can be purchased in multiple sizes. Rat Prolactin Receptor Specifications: (Molecular Weight: 24.6 kDa) (Amino Acid Sequence: QSPPGKPEIH KCRSPDKETF TCWWNPGTDG GLPTNYSLTY SKEGEKTTYE CPDYKTSGPN SCFFSKQYTS IWKIYIITVN ATNQMGSSSS DPLYVDVTYI VEPEPPRNLT LEVKQLKDKK TYLWVKWSPP TITDVKTGWF TMEYEIRLKP EEAEEWEIHF TGHQTQFKVF DLYPGQKYLV QTRCKPDHGY WSRWSQESSV EMPNDFTLKD (210)) (Gene ID: 24684). For research use only. Made in the USA
Kingfisher Biotech Inc Mouse CXCL1 Recombinant Protein
The Mouse CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. Mouse CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse CXCL1 Specifications: (Molecular Weight: 7.4 kDa) (Amino Acid Sequence: NELRCQCLQT MAGIHLKNIQ SLKVLPSGPH CTQTEVIATL KNGREACLDP EAPLVQKIVQ KMLKGVPK (68)) (Gene ID: 14825). For research use only. Made in the USA
Kingfisher Biotech Inc Equine IL-36RA Recombinant Protein
The Equine IL-36 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-36 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. Equine IL-36 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-36 Receptor Antagonist Specifications: (Molecular Weight: 17.0 kDa) (Amino Acid Sequence: VLSGALCFRM KDAALKVLYL HDNQLLAGGL HTGKVMKGEE ISVVPNRFLD AKLSPVILGV QGGSQCLSCG TEQEPTLKLE PVNIMELYLG AKEYKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLPEDAS GDDPITDFYF QQCD (154)) (Gene ID: 100065154). For research use only. Made in the USA
Kingfisher Biotech Inc Mouse IL-36RA Recombinant Protein
The Mouse IL-36 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-36 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. Mouse IL-36 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-36 Receptor Antagonist Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: VLSGALCFRM KDSALKVLYL HNNQLLAGGL HAEKVIKGEE ISVVPNRALD ASLSPVILGV QGGSQCLSCG TEKGPILKLE PVNIMELYLG AKESKSFTFY RRDMGLTSSF ESAAYPGWFL CTSPEADQPV RLTQIPEDPA WDAPITDFYF QQCD (154)) (Gene ID: 54450). For research use only. Made in the USA
Kingfisher Biotech Inc Equine CXCL3 Recombinant Protein
The Equine CXCL3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CXCL3 applications are for cell culture, ELISA standard, and Western Blot Control. Equine CXCL3 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CXCL3 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APVVSELRCQ CLQTVQGIHQ KNIQSVKVTP AGSHCAQTEV IATLKNGQKA CLNPAAPMVK KMIDRMLNKG STN (73)) (Gene ID: 100056258). For research use only. Made in the USA