Test
Chicken, Whole Blood, Na Heparin, Donor, Gender Unspecified, 100 Ml
Chicken, Whole Blood, Alsevers, Donor, Gender Unspecified, 50 Ml
NC2539742 CHICKEN BLOOD NA CITRATE 100ML
Chicken, Whole Blood, Na Citrate, Donor, Gender Unspecified, 50 Ml
Chicken, Whole Blood, K2 Edta, Donor, Gender Unspecified, 100 Ml
Chicken whole blood is aseptically collected and prepared to order from our colony of animals. These cell suspensions are useful for the titration of complement, adsorption procedures, testing for agglutinins/HA assays, and for the preparation of stroma as particulate reagents. Chicken red blood cells are perishable and are collected and processed upon receipt of your order.
The Feline IL-4 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-4 Biotinylated applications are for cell culture. Control. Feline IL-4 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-4 Biotinylated Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: QNFNNTLKEI IKTLNILTAR NDSCMELTVM DVLAAPKNTS DKEIFCRATT VLRQIYTHHN CSTKFLKGLD RNLSSMANRT CSVNEVKKCT LKDFLERLKA IMQKKYSKH (109)) (Gene ID: 751514). For research use only. Made in the USA
The Bovine CXCL9 (MIG) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL9 (MIG) Biotinylated applications are for cell culture. Control. Bovine CXCL9 (MIG) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL9 (MIG) Biotinylated Specifications: (Molecular Weight: 11.9 kDa) (Amino Acid Sequence: VPAIRNGRCS CINTSQGMIH PKSLKDLKQF APSPSCEKTE IIATMKNGNE ACLNPDLPEV KELIKEWEKQ VNQKKKQRKG KKYKKTKKVP KVKRSQRPSQ KKTT) (Gene ID: 513990). For research use only. Made in the USA
The Swine TNF alpha Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha Biotinylated applications are for cell culture. Control. Swine TNF alpha Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086). For research use only. Made in the USA
The Swine IL-4 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-4 Biotinylated applications are for cell culture. Control. Swine IL-4 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-4 Biotinylated Specifications: (Molecular Weight: 12.5 kDa) (Amino Acid Sequence: HKCDITLQEI IKTLNILTAR KNSCMELPVT DVFAAPENTT EKETFCRAST VLRHIYRHHT CMKSLLSGLD RNLSSMANMT CSVHEAKKST LKDFLERLKT IMKEKYSKC (109)) (Gene ID: 397225). For research use only. Made in the USA
The Chicken IFN gamma Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN gamma Biotinylated applications are for cell culture. Control. Chicken IFN gamma Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN gamma Biotinylated Specifications: (Molecular Weight: 16.7 kDa) (Amino Acid Sequence: HTASSLNLVQLQDDIDKLKADFNSSHSDVADGGPIIVEKLKNWTERNEKRIILSQIVSMYLEMLENTDKSKPHTKHISEELYTLKNNLPDGVKKVKDIMDLAKLPMNDLRIQRKAANELFSILQKLVDPPSFKRKRSQSQRRCNC) (Gene ID: 396054). For research use only. Made in the USA
The Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 (TL1A; VEGI) Biotinylated applications are for cell culture. Control. Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 (TL1A; VEGI) Biotinylated Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247). For research use only. Made in the USA
The Hamster CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Hamster CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. Hamster CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Hamster CXCL10 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: IPLSRTVRCS CIKIDDRPVK PRALGKLEII PASQSCPRVE IIVTMKKTEE KRCLNPESEA IKSLLKAVSQ RRSKRAS (77)) (Gene ID: 101840942). For research use only. Made in the USA
The Equine Leukemia Inhibitory Factor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine Leukemia Inhibitory Factor applications are for cell culture, ELISA standard, and Western Blot Control. Equine Leukemia Inhibitory Factor yeast-derived recombinant protein can be purchased in multiple sizes. Equine Leukemia Inhibitory Factor Specifications: (Molecular Weight: 21.3 kDa) (Amino Acid Sequence: SPLPITPDNA TCATRHPCHS NLMDQIRNQL VQLNSSANAL FILYYTAQGE PFPSNLDKLC RPDVTDFPPF HANGKEKARL VELYRIIAYL GASLGNITRD QKVLNPNALS LHSKLNATSD TMRGLLSNVL CHLCSKYHVA NVDVAYGPDT SNKDVFQKKK LGCQLLGKYK QVIAVVAQAF QTGDLEAYSD PRS (193)) (Gene ID: 100629131). For research use only. Made in the USA
The Human CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Human CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Human CCL8 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: QPDSVSIPIT CCFNVINRKI PIQRLESYTR ITNIQCPKEA VIFKTKRGKE VCADPKERWV RDSMKHLDQI FQNLKP (76)) (Gene ID: 6355). For research use only. Made in the USA