Choose the brand aligned with your industry so we can best serve your needs.
For researchers, scientists, and technical professionals: Your one-stop shop for the complete range of laboratory, production, and safety products and services.
Diluent A is the special diluent used in Interference Test Kit (K2010001) and Interference Test Kit EXTRA (K2010008) This diluent can be spiked into the control specimen when testing the interference of Conjugated Bilirubin Ascorbic Acid Hemoglobin Serum Proteins Triglycerides Creatinine Glucose Glycerol EDTA Intralipids Urea and any other interference substance provided by Molecular Depot except Free Bilirubin and Uric Acid For in vitro research use only
Encompass Procurement Services Non-distribution item offered as a customer accommodation; additional freight charges may apply. Learn More
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in conjunction with Cayman’s EP4 Receptor Polyclonal Antibody (Item No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.
Encompass Procurement Services Non-distribution item offered as a customer accommodation; additional freight charges may apply. Learn More
A very long-chain fatty acid methyl ester; has been found in transesterified palm oil, biodiesel produced by the microalga Botryococcus, and in sediment samples from Lake Kivu in the EAst African rift valley
Encompass Procurement Services Non-distribution item offered as a customer accommodation; additional freight charges may apply. Learn More