Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

1,486 – 1,500 of 1,675,336 results

1,486

Promotions Available

Invitrogen™ CD49a (Integrin alpha 1) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P18614, P56199, Q3V3R4
Isotype	IgG
Concentration	500 μg/mL
Antigen	CD49a (Integrin alpha 1)
Gene Symbols	Itga1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CD49 antigen-like family member A; CD49a; E130012M19Rik; integrin alpha 1; integrin alpha-1; integrin subunit alpha 1; integrin, alpha 1; Itga1; Laminin and collagen receptor; very late activation protein 1; Vla1; VLA-1
Gene	Itga1
Product Type	Antibody
Gene ID (Entrez)	109700, 25118, 3672
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human Integrin alpha 1 (1121-1134aa SNQKRELAIQISKD).
Classification	Polyclonal
Primary or Secondary	Primary

1,487

Promotions Available

Invitrogen™ S100B Monoclonal Antibody (4C4.9)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Bovine,Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P02638, P04271, P50114
Isotype	IgG2a κ
Concentration	0.2 mg/mL
Antigen	S100B
Gene Symbols	S100B
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	AI850290; Bpb; hypothetical protein LOC525716; NEF; protein S100-B; S100; S100 calcium binding protein B; S100 calcium binding protein beta (neural); S100 calcium-binding protein B; S100 calcium-binding protein beta (neural); S-100 calcium-binding protein beta subunit; S100 calcium-binding protein, beta (neural); S-100 calcium-binding protein, beta chain; S100 protein beta chain; S-100 protein beta chain; S-100 protein subunit beta; S100 protein, beta polypeptide; S100 protein, beta polypeptide, neural; S100B; S100-B; S100beta; S100P
Gene	S100B
Product Type	Antibody
Gene ID (Entrez)	20203, 525716, 6285
Formulation	PBS with 0.05% BSA and 0.05% sodium azide; pH 7.4
Immunogen	Purified bovine brain S100 protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	4C4.9

1,488

Promotions Available

SIGLEC H Monoclonal Antibody (eBio440c), APC, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Concentration	0.2 mg/mL
Antigen	SIGLEC H
Gene Symbols	Siglech
Regulatory Status	RUO
Gene	Siglech
Product Type	Antibody
Gene ID (Entrez)	233274
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBio440c

1,489

Promotions Available

Invitrogen™ E-cadherin Monoclonal Antibody (NCH-38)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P09803, P12830
Isotype	IgG1 κ
Concentration	Conc. Not Determined
Antigen	E-cadherin
Gene Symbols	CDH1
Regulatory Status	RUO
Gene Alias	AA960649; ARC-1; cadherin 1; cadherin 1, E-cadherin (epithelial); cadherin 1, epithelial; cadherin 1, type 1; cadherin 1, type 1, E-cadherin (epithelial); cadherin e; cadherin-1; cadherin-E; calcium-dependent adhesion protein, epithelial; CAM 120/80; CD324; CDH1; CDHE; cell adhesion molecule; cell-CAM 120/80; ECAD; E-cad; E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3; Ecadherin; E-cadherin; E-cadherin 1; E-cadherin precursor; Epithelial cadherin; hab; half baked; LCAM; L-CAM; Um; UVO; Uvomorulin
Gene	CDH1
Product Type	Antibody
Gene ID (Entrez)	12550, 999
Formulation	Tissue culture supernatant with 0.09% sodium azide
Immunogen	E-cadherin and GST recombinant protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	NCH-38

1,490

Promotions Available

Invitrogen™ MHC Class II Monoclonal Antibody (HIS19), PE, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Rat
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1
Concentration	0.2 mg/mL
Antigen	MHC Class II
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	beta 1 domain; B-L; B-L beta chain; B-L beta minor; B-LB; BLB major; BLB1; BLB2; B-LB2; B-LB21; B-LB21 major; BLB3; Bl-Beta II protein; B-LBII; class II histocompatibility antigen, B-L beta chain; class II histocompatibility antigen, M alpha chain; D6S222E; DMA; FECA-DRB; GSP-BLB1; GSP-BLB2; HLA class II histocompatibility antigen, DM alpha chain; HLADM; HLA-DMA; major histocompatibility class II antigen B-L beta; major histocompatibility complex class II B; Major histocompatibility complex class II beta chain BLB1; Major histocompatibility complex class II beta chain BLB1, (similar to HLA class II, D beta chain); major histocompatibility complex class II beta chain BLB1, (similar to HLA class II, D beta chain); Major histocompatibility complex class II beta chain BLB2, (similar to HLA class II, D beta chain); Major histocompatibility complex class II beta chain BLB3, (similar to HLA class II, D beta chain); major histocompatibility complex, class II, DM alpha; MHC 2; MHC Class II; MHC class II antigen; MHC class II antigen beta chain; MHC class II antigen B-F minor heavy chain; MHC class II antigen DMA; MHC class II antigen DRB; MHC Class II beta 1 and 2 domains; MHC class II beta 1 domain; MHC class II beta chain; MHC class II beta chain 1; MHC class II beta chain 2; MHC class II B-L beta chain; MHC II; MHCCII; MHCFECA-DRB; really interesting new gene 6 protein; RING6; S19; uncharacterized protein LOC101747454
Product Type	Antibody
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HIS19

1,491

Promotions Available

CD3 Monoclonal Antibody (UCHT1), Alexa Fluor™ 660, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor 660
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P04234, P07766, P09693, P20963
Concentration	5 μL/Test
Antigen	CD3
Gene Symbols	Cd247, Cd3d, CD3E, CD3g
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	4930549J05Rik; A430104F18Rik; AI504783; antigen CD3D, delta polypeptide (TiT3 complex); antigen CD3E, epsilon polypeptide (TiT3 complex); antigen CD3G, gamma polypeptide; antigen CD3Z, zeta polypeptide; AW552088; Cd247; CD247 antigen; CD247 antigen, zeta subunit; Cd247 molecule; CD3; CD3 antigen delta chain; CD3 antigen delta polypeptide; CD3 antigen gamma chain; CD3 antigen, delta polypeptide; CD3 antigen, delta subunit; CD3 antigen, epsilon polypeptide; CD3 antigen, gamma polypeptide; CD3 antigen, zeta polypeptide; CD3 delta; CD3 epsilon; CD3 epsilon chain; CD3 epsilon subunit; CD3 epsilon subunit precursor; CD3 gamma-chain; CD3 glycoprotein; CD3 glycoprotein precursor; CD3 molecule delta polypeptide; CD3 molecule, delta; CD3 molecule, epsilon; CD3 molecule, epsilon polypeptide; CD3 molecule, gamma; CD3 molecule, gamma polypeptide; CD3 protein; CD3 TCR complex; CD3 type I transmembrane glycoprotein; CD3 type I transmembrane glycoprotein precursor; CD3 zeta chain; Cd3d; CD3D antigen delta; CD3D antigen, delta polypeptide (TiT3 complex); CD3d molecule; CD3d molecule, delta (CD3-TCR complex); CD3-DELTA; Cd3e; CD3E antigen, epsilon polypeptide; CD3E antigen, epsilon polypeptide (TiT3 complex); CD3e molecule; CD3e molecule, epsilon (CD3-TCR complex); CD3epsilon; CD3-epsilon; Cd3-eta; Cd3g; CD3G antigen, gamma polypeptide; CD3g antigen, gamma polypeptide (TiT3 complex); CD3g molecule; CD3g molecule, epsilon (CD3-TCR complex); CD3g molecule, gamma (CD3-TCR complex); CD3-GAMMA; Cd3h; CD3Q; Cd3z; CD3Z antigen, zeta polypeptide (TiT3 complex); Cd3zeta; Cd3-zeta; CD3zeta chain; CD3-zeta/eta; Ctg3; Ctg-3; FLJ18683; IMD17; IMD18; IMD19; IMD25; Leu-4; OKT3, delta chain; T cell antigen receptor complex epsilon subunit of T3; T3/TCR complex; T3d; T3e; T3g; T3Z; T-cell antigen receptor complex, epsilon subunit of T3; T-cell antigen receptor complex, gamma subunit of T3; T-cell antigen receptor complex, zeta subunit of CD3; T-cell receptor CD3 epsilon chain; T-cell receptor CD3 epsilon subunit; T-cell receptor CD3 subunit zeta; T-cell receptor CD3, subunit zeta; T-cell receptor T3 delta chain; T-cell receptor T3 eta chain; T-cell receptor T3 gamma chain; T-cell receptor T3 zeta chain; T-cell receptor zeta chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 delta chain; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface glycoprotein CD3 gamma chain; T-cell surface glycoprotein CD3 zeta chain; T-cell surface protein; TcR CD3 delta-chain; TcR CD3 gamma-chain; TCR zeta chain; TCR zeta chain subunit; TCRE; Tcrk; TCRZ; TCRzeta; TiT3 complex; type I transmembrane protein; T-cell surface molecule CD3
Product Type	Antibody
Gene ID (Entrez)	915, 916, 917, 919
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	UCHT1

1,492

Promotions Available

Invitrogen™ SIGLEC H Monoclonal Antibody (eBio440c), Functional Grade, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Rat
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay
Form	Liquid
Gene Accession No.	0
Isotype	IgG2b κ
Concentration	1 mg/mL
Antigen	SIGLEC H
Gene Symbols	Siglech
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	6430529G09Rik; sialic acid binding Ig-like lectin H; Siglec; Siglech; Siglec-H; SIGLEC-like protein
Gene	Siglech
Product Type	Antibody
Gene ID (Entrez)	233274
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBio440c

1,493

Promotions Available

CD152 (CTLA-4) Monoclonal Antibody (9H10), Functional Grade, eBioscience™, Invitrogen™

Syrian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Syrian Hamster
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay
Form	Liquid
Isotype	IgG
Gene Accession No.	P09793
Concentration	1 mg/mL
Antigen	CD152 (CTLA-4)
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	ALPS5; CD; CD152; CD152 antigen; CD152 isoform; CD152 protein; CD152 protein precursor; celiac disease 3; CELIAC3; Ctla4; CTLA-4; cytotoxic T lymphocyte associated antigen 4 short spliced form; cytotoxic T-lymphocyte associated protein 4; cytotoxic T-lymphocyte protein 4; cytotoxic T-lymphocyte protein 4 isoform CTLA4-TM; cytotoxic T-lymphocyte-associated antigen 4; cytotoxic T-lymphocyte-associated protein 4; cytotoxic T-lymphocyte-associated serine esterase-4; EGK_04712; GRD4; GSE; ICOS; IDDM12; insulin-dependent diabetes mellitus 12; ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; Ly-56; sCTLA4; soluble form; transmembrane form
Gene	CTLA4
Product Type	Antibody
Gene ID (Entrez)	12477
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	9H10

1,494

Promotions Available

CD154 (CD40 Ligand) Monoclonal Antibody (MR1), Functional Grade, eBioscience™, Invitrogen™

Armenian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Armenian Hamster
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay,Neutralization
Form	Liquid
Isotype	IgG
Gene Accession No.	P27548
Concentration	1 mg/mL
Antigen	CD154 (CD40 Ligand)
Gene Symbols	CD40LG
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD154; CD40 antigen ligand; CD40 ligand; CD40 ligand CD154; CD40 ligand, membrane form; CD40 ligand, soluble form; CD40L; CD40-L; Cd40lg; gp39; hCD40L; H-CD-40-L; HIGM1; IGM; IMD3; Ly62; Ly-62; M-CD-40-L; RP23-153G22.3; T-B cell-activating molecule; T-BAM; T-cell antigen Gp39; TNF-related activation protein; TNFSF5; TRAP; tumor necrosis factor (ligand) superfamily member 5; tumor necrosis factor (ligand) superfamily, member 5; tumor necrosis factor ligand superfamily member 5
Gene	CD40LG
Product Type	Antibody
Gene ID (Entrez)	21947
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MR1

1,495

Invitrogen™ IL-10 Monoclonal Antibody (JES3-9D7), Brilliant Violet™ 480, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Rat
Conjugate	Brilliant Violet 480
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P22301
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	IL-10
Gene Symbols	IL10
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CSIF; cytokine; Cytokine synthesis inhibitory factor; GVHDS; H-IL-10; il 10; IL10; IL-10; IL-10 precursor; IL10A; IL10X; ILN; Interleukin; interleukin 10; Interleukin10; interleukin-10; MGC126450; MGC126451; RP11-262N9.1; T-cell growth inhibitory factor; TGIF
Gene	IL10
Product Type	Antibody
Gene ID (Entrez)	3586
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	JES3-9D7

1,496

Invitrogen™ CD45R Monoclonal Antibody (RA3-6B2), APC-Cyanine7

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Feline,Human,Mouse
Host Species	Rat
Conjugate	APC-Cyanine7
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P06800, P08575
Isotype	IgG2a κ
Concentration	0.1 mg/mL
Antigen	CD45R
Gene Symbols	PTPRC
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	B220; Cd45; CD45 antigen; CD45R; GP180; Lca; L-CA; leucocyte common antigen; leukocyte common antigen; leukocyte common antigen A; leukocyte common antigen B; loc; LY5; Ly-5; Lymphocyte antigen 5; lymphocyte common antigen; Lyt-4; membrane tyrosine phosphatase; protein tyrosine phosphatase receptor type C; protein tyrosine phosphatase, receptor type C; protein tyrosine phosphatase, receptor type, C; protein tyrosine phosphatase, receptor type, c polypeptide; Protein tyrosine phosphatase, receptor-type, c polypeptide; Ptprc; Receptor-type tyrosine-protein phosphatase C; RT7; T200; T200 glycoprotein; T200 leukocyte common antigen
Gene	PTPRC
Product Type	Antibody
Gene ID (Entrez)	101097123, 19264, 5788
Formulation	PBS with proprietary stabilizer and <0.1% sodium azide; pH 7.1
Immunogen	exon A-specific epitope on CD45 from Abelson murine leukemia virus-induced pre-B cell lymphoma.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RA3-6B2

1,497

Promotions Available

Invitrogen™ Involucrin Monoclonal Antibody (SY5)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Canine,Human,Monkey,Pig,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form	Liquid
Gene Accession No.	P07476, P18174, P18175, P48998
Isotype	IgG1 κ
Concentration	0.2 mg/mL
Antigen	Involucrin
Gene Symbols	IVL
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	1110019C06Rik; involucrin; IVL
Gene	IVL
Product Type	Antibody
Gene ID (Entrez)	101125010, 102152041, 3713, 407242, 60583
Formulation	PBS with 0.05% BSA and 0.05% sodium azide; pH 7.4
Immunogen	Human keratinocytes' involucrin.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SY5

1,498

Promotions Available

MHC Class II I-Ab Monoclonal Antibody (AF6-120.1), eFluor™ 450, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Mouse
Conjugate	eFluor 450
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Concentration	0.2 mg/mL
Antigen	MHC Class II I-Ab
Gene Symbols	H2-Ab1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	H2-Ab1
Product Type	Antibody
Gene ID (Entrez)	14961
Classification	Monoclonal
Primary or Secondary	Primary
Clone	AF6-120.1

1,499

Promotions Available

CD3 Monoclonal Antibody (17A2), eFluor™ 660, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	eFluor 660
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Immunocytochemistry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P04235, P11942, P22646, P24161
Concentration	0.2 mg/mL
Antigen	CD3
Gene Symbols	Cd247, Cd3d, CD3E, CD3g
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	4930549J05Rik; A430104F18Rik; AI504783; antigen CD3D, delta polypeptide (TiT3 complex); antigen CD3E, epsilon polypeptide (TiT3 complex); antigen CD3G, gamma polypeptide; antigen CD3Z, zeta polypeptide; AW552088; Cd247; CD247 antigen; CD247 antigen, zeta subunit; Cd247 molecule; CD3; CD3 antigen delta chain; CD3 antigen delta polypeptide; CD3 antigen gamma chain; CD3 antigen, delta polypeptide; CD3 antigen, delta subunit; CD3 antigen, epsilon polypeptide; CD3 antigen, gamma polypeptide; CD3 antigen, zeta polypeptide; CD3 delta; CD3 epsilon; CD3 epsilon chain; CD3 epsilon subunit; CD3 epsilon subunit precursor; CD3 gamma-chain; CD3 glycoprotein; CD3 glycoprotein precursor; CD3 molecule delta polypeptide; CD3 molecule, delta; CD3 molecule, epsilon; CD3 molecule, epsilon polypeptide; CD3 molecule, gamma; CD3 molecule, gamma polypeptide; CD3 protein; CD3 TCR complex; CD3 type I transmembrane glycoprotein; CD3 type I transmembrane glycoprotein precursor; CD3 zeta chain; Cd3d; CD3D antigen delta; CD3D antigen, delta polypeptide (TiT3 complex); CD3d molecule; CD3d molecule, delta (CD3-TCR complex); CD3-DELTA; Cd3e; CD3E antigen, epsilon polypeptide; CD3E antigen, epsilon polypeptide (TiT3 complex); CD3e molecule; CD3e molecule, epsilon (CD3-TCR complex); CD3epsilon; CD3-epsilon; Cd3-eta; Cd3g; CD3G antigen, gamma polypeptide; CD3g antigen, gamma polypeptide (TiT3 complex); CD3g molecule; CD3g molecule, epsilon (CD3-TCR complex); CD3g molecule, gamma (CD3-TCR complex); CD3-GAMMA; Cd3h; CD3Q; Cd3z; CD3Z antigen, zeta polypeptide (TiT3 complex); Cd3zeta; Cd3-zeta; CD3zeta chain; CD3-zeta/eta; Ctg3; Ctg-3; FLJ18683; IMD17; IMD18; IMD19; IMD25; Leu-4; OKT3, delta chain; T cell antigen receptor complex epsilon subunit of T3; T3/TCR complex; T3d; T3e; T3g; T3Z; T-cell antigen receptor complex, epsilon subunit of T3; T-cell antigen receptor complex, gamma subunit of T3; T-cell antigen receptor complex, zeta subunit of CD3; T-cell receptor CD3 epsilon chain; T-cell receptor CD3 epsilon subunit; T-cell receptor CD3 subunit zeta; T-cell receptor CD3, subunit zeta; T-cell receptor T3 delta chain; T-cell receptor T3 eta chain; T-cell receptor T3 gamma chain; T-cell receptor T3 zeta chain; T-cell receptor zeta chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 delta chain; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface glycoprotein CD3 gamma chain; T-cell surface glycoprotein CD3 zeta chain; T-cell surface protein; TcR CD3 delta-chain; TcR CD3 gamma-chain; TCR zeta chain; TCR zeta chain subunit; TCRE; Tcrk; TCRZ; TCRzeta; TiT3 complex; type I transmembrane protein; T-cell surface molecule CD3
Product Type	Antibody
Gene ID (Entrez)	12500, 12501, 12502, 12503
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	17A2

1,500

Promotions Available

Invitrogen™ CYP27B1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O15528, O35084, O35132
Isotype	IgG
Concentration	500 μg/mL
Antigen	CYP27B1
Gene Symbols	CYP27B1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1alpha(OH)ase; 25 hydroxyvitamin D3-1-alpha hydroxylase; 25(OH)D 1alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha); 25-hydroxyvitamin D3 1alpha-hydroxylase; 25-OHD-1 alpha-hydroxylase; Calcidiol 1-monooxygenase; Cp2b; cy; Cyp1; CYP1alpha; Cyp27b; Cyp27b1; Cyp40; cytochrome p450 27B1; cytochrome P450 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450 family 27 subfamily B member 1; cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1; cytochrome P450 subfamily XXVIIB polypeptide 1; cytochrome P450, 27b1; cytochrome P450, 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450, family 27, subfamily B, polypeptide 1; cytochrome P450, subfamily 27b, polypeptide 1; cytochrome P450C1 alpha; Cytochrome P450VD1-alpha; P450c1; P450C1 alpha; P450VD1alpha; P450VD1-alpha; Pddr; VD3 1A hydroxylase; Vdd1; Vddr; VDDRI; VDR
Gene	CYP27B1
Product Type	Antibody
Gene ID (Entrez)	114700, 13115, 1594
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR).
Classification	Polyclonal
Primary or Secondary	Primary

Prev
1
...
98
99
100
101
...
111,690
Next

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ CD49a (Integrin alpha 1) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ S100B Monoclonal Antibody (4C4.9) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

SIGLEC H Monoclonal Antibody (eBio440c), APC, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ E-cadherin Monoclonal Antibody (NCH-38) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MHC Class II Monoclonal Antibody (HIS19), PE, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD3 Monoclonal Antibody (UCHT1), Alexa Fluor™ 660, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SIGLEC H Monoclonal Antibody (eBio440c), Functional Grade, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD152 (CTLA-4) Monoclonal Antibody (9H10), Functional Grade, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD154 (CD40 Ligand) Monoclonal Antibody (MR1), Functional Grade, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ IL-10 Monoclonal Antibody (JES3-9D7), Brilliant Violet™ 480, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD45R Monoclonal Antibody (RA3-6B2), APC-Cyanine7 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Involucrin Monoclonal Antibody (SY5) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

MHC Class II I-Ab Monoclonal Antibody (AF6-120.1), eFluor™ 450, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD3 Monoclonal Antibody (17A2), eFluor™ 660, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CYP27B1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD49a (Integrin alpha 1) Polyclonal Antibody

Invitrogen™ S100B Monoclonal Antibody (4C4.9)

SIGLEC H Monoclonal Antibody (eBio440c), APC, eBioscience™, Invitrogen™

Invitrogen™ E-cadherin Monoclonal Antibody (NCH-38)

Invitrogen™ MHC Class II Monoclonal Antibody (HIS19), PE, eBioscience™

CD3 Monoclonal Antibody (UCHT1), Alexa Fluor™ 660, eBioscience™, Invitrogen™

Invitrogen™ SIGLEC H Monoclonal Antibody (eBio440c), Functional Grade, eBioscience™

CD152 (CTLA-4) Monoclonal Antibody (9H10), Functional Grade, eBioscience™, Invitrogen™

CD154 (CD40 Ligand) Monoclonal Antibody (MR1), Functional Grade, eBioscience™, Invitrogen™

Invitrogen™ IL-10 Monoclonal Antibody (JES3-9D7), Brilliant Violet™ 480, eBioscience™

Invitrogen™ CD45R Monoclonal Antibody (RA3-6B2), APC-Cyanine7

Invitrogen™ Involucrin Monoclonal Antibody (SY5)

MHC Class II I-Ab Monoclonal Antibody (AF6-120.1), eFluor™ 450, eBioscience™, Invitrogen™

CD3 Monoclonal Antibody (17A2), eFluor™ 660, eBioscience™, Invitrogen™

Invitrogen™ CYP27B1 Polyclonal Antibody