Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

1,966 – 1,980 of 1,911,151 results

1,966

CD279 (PD-1) Monoclonal Antibody (RMP1-30), PE, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	Q02242
Concentration	0.2 mg/mL
Antigen	CD279 (PD-1)
Gene Symbols	Pdcd1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD279; EGK_05005; hPD1; hPD-1; hPD-l; hSLE1; Ly101; mPD-1; PD1; PD-1; Pdc1; Pdcd1; programmed cell death 1; programmed cell death 1 protein; programmed cell death protein 1; programmed cell death protein 1-like; programmed death 1; Protein PD1; protein PD-1; sCD279; SLEB2; soluble CD279; systemic lupus erythematosus susceptibility 2
Gene	Pdcd1
Product Type	Antibody
Gene ID (Entrez)	18566
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RMP1-30

1,967

Invitrogen™ Coramitug Chimeric Recombinant Human Monoclonal Antibody

Human Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Human
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Functional Assay
Form	Liquid
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	Coramitug Chimeric
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	NN-6019; NNC6019-0001; PRX004
Product Type	Antibody
Formulation	PBS with no preservative; pH 7.4
Classification	Recombinant Monoclonal
Primary or Secondary	Primary

1,968

Invitrogen™ SNAP25 Monoclonal Antibody (SP12), Biotin

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Biotin
Applications	ELISA,Flow Cytometry,Western Blot
Form	Liquid
Gene Accession No.	P60880
Isotype	IgG1
Concentration	0.1 mg/mL
Antigen	SNAP25
Gene Symbols	Snap25
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	ALMS1; bA416N4.2; Bdr; blind drunk; CG17676; CG17884; CG40452; CMS18; dJ1068F16.2; Dmel CG40452; Dmel_CG40452; etID17571.20; etID69167.20; fj42b02; fj45g04; fj48c02; FLJ23079; GENA70; HGNC:11132; resistance to inhibitors of cholinesterase 4 homolog; RIC4; RIC-4; SEC9; si:dkeyp-8f4.6; Snap; SNAP 25; snap25; SNAP-25; snap25.1; SNAP-25.1; snap25a; SNAP-25A; SNAP-25B; snp25; sp; SUP; super protein; synaptosomal associated protein-25; synaptosomal-associated 25 kDa protein; Synaptosomal-associated protein 25; synaptosomal-associated protein 25-A; synaptosomal-associated protein, 25 kDa; synaptosomal-associated protein, 25a; synaptosomal-associated protein, 25kDa; synaptosome associated protein 25; synaptosome associated protein 25a; synaptosome associated protein 25kDa; synaptosome-associated protein 25.1; synaptosome-associated protein 25a; wu:fj42b02; wu:fj45g04; wu:fj48c02
Gene	Snap25
Product Type	Antibody
Gene ID (Entrez)	6616
Formulation	PBS with 4-5mg/mL BSA and 0.02% sodium azide
Immunogen	Synaptic preparation of post mortem human brain.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SP12

1,969

Invitrogen™ CD3 Monoclonal Antibody (SK7), PerCP-eFluor™ 710, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Chimpanzee
Host Species	Mouse
Conjugate	PerCP-eFluor 710
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P04234, P07766, P09693, P20963
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD3
Gene Symbols	Cd247, Cd3d, CD3E, CD3g
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	4930549J05Rik; A430104F18Rik; AI504783; antigen CD3D, delta polypeptide (TiT3 complex); antigen CD3E, epsilon polypeptide (TiT3 complex); antigen CD3G, gamma polypeptide; antigen CD3Z, zeta polypeptide; AW552088; Cd247; CD247 antigen; CD247 antigen, zeta subunit; Cd247 molecule; CD3; CD3 antigen delta chain; CD3 antigen delta polypeptide; CD3 antigen gamma chain; CD3 antigen, delta polypeptide; CD3 antigen, delta subunit; CD3 antigen, epsilon polypeptide; CD3 antigen, gamma polypeptide; CD3 antigen, zeta polypeptide; CD3 delta; CD3 epsilon; CD3 epsilon chain; CD3 epsilon subunit; CD3 epsilon subunit precursor; CD3 gamma-chain; CD3 glycoprotein; CD3 glycoprotein precursor; CD3 molecule delta polypeptide; CD3 molecule, delta; CD3 molecule, epsilon; CD3 molecule, epsilon polypeptide; CD3 molecule, gamma; CD3 molecule, gamma polypeptide; CD3 protein; CD3 TCR complex; CD3 type I transmembrane glycoprotein; CD3 type I transmembrane glycoprotein precursor; CD3 zeta chain; Cd3d; CD3D antigen delta; CD3D antigen, delta polypeptide (TiT3 complex); CD3d molecule; CD3d molecule, delta (CD3-TCR complex); CD3-DELTA; Cd3e; CD3E antigen, epsilon polypeptide; CD3E antigen, epsilon polypeptide (TiT3 complex); CD3e molecule; CD3e molecule, epsilon (CD3-TCR complex); CD3epsilon; CD3-epsilon; Cd3-eta; Cd3g; CD3G antigen, gamma polypeptide; CD3g antigen, gamma polypeptide (TiT3 complex); CD3g molecule; CD3g molecule, epsilon (CD3-TCR complex); CD3g molecule, gamma (CD3-TCR complex); CD3-GAMMA; Cd3h; CD3Q; Cd3z; CD3Z antigen, zeta polypeptide (TiT3 complex); Cd3zeta; Cd3-zeta; CD3zeta chain; CD3-zeta/eta; Ctg3; Ctg-3; FLJ18683; IMD17; IMD18; IMD19; IMD25; Leu-4; OKT3, delta chain; T cell antigen receptor complex epsilon subunit of T3; T3/TCR complex; T3d; T3e; T3g; T3Z; T-cell antigen receptor complex, epsilon subunit of T3; T-cell antigen receptor complex, gamma subunit of T3; T-cell antigen receptor complex, zeta subunit of CD3; T-cell receptor CD3 epsilon chain; T-cell receptor CD3 epsilon subunit; T-cell receptor CD3 subunit zeta; T-cell receptor CD3, subunit zeta; T-cell receptor T3 delta chain; T-cell receptor T3 eta chain; T-cell receptor T3 gamma chain; T-cell receptor T3 zeta chain; T-cell receptor zeta chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 delta chain; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface glycoprotein CD3 gamma chain; T-cell surface glycoprotein CD3 zeta chain; T-cell surface protein; TcR CD3 delta-chain; TcR CD3 gamma-chain; TCR zeta chain; TCR zeta chain subunit; TCRE; Tcrk; TCRZ; TCRzeta; TiT3 complex; type I transmembrane protein; T-cell surface molecule CD3
Gene	CD3g
Product Type	Antibody
Gene ID (Entrez)	451584, 451585, 742330, 748272, 915, 916, 917, 919
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SK7

1,970

Invitrogen™ Nur77 Monoclonal Antibody (12.14), eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P12813
Isotype	IgG1 κ
Concentration	0.5 mg/mL
Antigen	Nur77
Gene Symbols	NR4A1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	early response protein NAK1; Gfrp; GFRP1; growth factor-inducible nuclear protein N10; Hbr1; Hbr-1; Hmr; hormone receptor; immediate early gene transcription factor NGFI-B; MGC9485; N10; NAK1; NAK-1; nerve growth factor IB nuclear receptor variant 1; nerve growth factor induced protein I-B; nerve growth factor-induced protein I-B; Ngfib; NGFI-B; NP10; Nr4a1; Nuclear hormone receptor NUR/77; nuclear protein N10; Nuclear receptor subfamily 4 group A member 1; nuclear receptor subfamily 4, group A, member 1; NUR77; Orphan nuclear receptor HMR; orphan nuclear receptor TR3; Orphan receptor tr3; ST-59; steroid receptor TR3; testicular receptor 3; TIS1; TR3; TR3 orphan receptor
Gene	NR4A1
Product Type	Antibody
Gene ID (Entrez)	15370
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	12.14

1,971

Invitrogen™ IL-17A Monoclonal Antibody (41809)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Monkey
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin),Immunoprecipitation,Neutralization
Form	Lyophilized
Gene Accession No.	Q16552
Isotype	IgG2b
Concentration	0.5 mg/mL
Antigen	IL-17A
Gene Symbols	IL17A
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	Ctla8; CTLA-8; cytokine; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; il 17; Il17; IL-17; IL17A; IL-17a; ILN; Interleukin; interleukin 17; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); interleukin 17 precursor; interleukin 17A; interleukin-17; Interleukin17A; interleukin-17A; R-IL-17-A
Gene	IL17A
Product Type	Antibody
Gene ID (Entrez)	3605
Formulation	PBS with 5% trehalose and No Preservative
Immunogen	E. coli-derived recombinant human IL-17 Ile20-Ala155.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	41809

1,972

Invitrogen™ CXCL13 Monoclonal Antibody (53610)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Neutralization,Western Blot
Form	Lyophilized
Gene Accession No.	O43927
Isotype	IgG1
Concentration	0.5 mg/mL
Antigen	CXCL13
Gene Symbols	Cxcl13
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	4631412M08Rik; Angie; ANGIE2; B cell-attracting chemokine 1; b lymphocyte chemoattractant; BCA1; BCA-1; B-cell chemoattractant; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); BLC; BLR1L; B-lymphocyte chemoattractant; C Cmotif chemokine; C X C motif chemokine; CC motif chemokine; CCmotif chemokine; chem; chemokine (C-X-C motif) ligand 13; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); CXC; CXC chemokine BLC; CXC motif chemokine; CXC motif chemokine 13; C-X-C motif chemokine 13; C-X-C motif chemokine ligand 13; CXCL; Cxcl13; SCYB13; small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); small inducible cytokine subfamily B (Cys-X-Cys), member 13; small-inducible cytokine B13
Gene	Cxcl13
Product Type	Antibody
Gene ID (Entrez)	10563
Formulation	PBS with 5% trehalose and No Preservative
Immunogen	E. coli-derived recombinant human CXCL13/BLC/BCA-1 Val23-Arg94.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	53610

1,973

Invitrogen™ GP130 Monoclonal Antibody (125623)

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse
Host Species	Rat
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	P40189, Q00560
Isotype	IgG2a
Concentration	0.5 mg/mL
Antigen	GP130
Gene Symbols	IL6ST
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	5133400A03Rik; AA389424; Ac1055; BB405851; CD130; CD130 antigen; CDW130; D13Ertd699e; EGK_16499; Gp130; gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form; gp130, oncostatin M receptor; GP130-RAPS; IL-6; IL-6 receptor subunit beta; IL-6R subunit beta; IL-6RB; IL-6R-beta; IL6R-beta; IL6ST; interleukin 6 signal transducer; interleukin 6 signal transducer (gp130, oncostatin M receptor); interleukin 6 signal transducer receptor; interleukin receptor beta chain; interleukin-6 receptor subunit beta; Interleukin-6 signal transducer; interleukin-6 signal transducer receptor; membrane glycoprotein; membrane glycoprotein 130; membrane glycoprotein gp130; oncostatin-M receptor subunit alpha
Gene	IL6ST
Product Type	Antibody
Gene ID (Entrez)	16195, 3572
Formulation	PBS with 5% trehalose and No Preservative
Immunogen	Mouse myeloma cell line NS0-derived recombinant mouse gp130 Gln23-Glu617 (predicted).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	125623

1,974

CD154 (CD40 Ligand) Monoclonal Antibody (MR1), APC, eBioscience™, Invitrogen™

Armenian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Armenian Hamster
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG
Gene Accession No.	P27548
Concentration	0.2 mg/mL
Antigen	CD154 (CD40 Ligand)
Gene Symbols	CD40LG
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD154; CD40 antigen ligand; CD40 ligand; CD40 ligand CD154; CD40 ligand, membrane form; CD40 ligand, soluble form; CD40L; CD40-L; Cd40lg; gp39; hCD40L; H-CD-40-L; HIGM1; IGM; IMD3; Ly62; Ly-62; M-CD-40-L; RP23-153G22.3; T-B cell-activating molecule; T-BAM; T-cell antigen Gp39; TNF-related activation protein; TNFSF5; TRAP; tumor necrosis factor (ligand) superfamily member 5; tumor necrosis factor (ligand) superfamily, member 5; tumor necrosis factor ligand superfamily member 5
Gene	CD40LG
Product Type	Antibody
Gene ID (Entrez)	21947
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MR1

1,975

Invitrogen™ TGFBR2 Monoclonal Antibody (2F11)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P37173
Isotype	IgG2b
Concentration	500 μg/mL
Antigen	TGFBR2
Gene Symbols	TGFBR2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1110020H15Rik; AAT3; AU042018; DNIIR; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; RIIDN; TAAD2; TbetaRII; TbetaR-II; TBR-II; tgf beta receptor 2; TGF-beta 2; TGF-beta receptor II; TGF-beta receptor type II; TGF-beta receptor type IIB; TGF-beta receptor type-2; TGFbeta RII; TGFbeta type II receptor; TGF-beta type II receptor; TGFbeta-RII; TGFBR2; Tgfbr2T; TGFR2; TGFR-2; transforming growth factor beta receptor 2; transforming growth factor beta receptor II; transforming growth factor beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor 2; transforming growth factor, beta receptor II; transforming growth factor, beta receptor II (70/80kDa); transforming growth factor, beta receptor II alpha; transforming growth factor, beta receptor II beta; transforming growth factor, beta receptor II delta; transforming growth factor, beta receptor II epsilon; transforming growth factor, beta receptor II gamma; transforming growth factor, beta receptor IIT; transforming growth factor-b type II receptor; transforming growth factor-beta receptor type II; transforming growth factor-beta type II receptor
Gene	TGFBR2
Product Type	Antibody
Gene ID (Entrez)	7048
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2F11

1,976

Invitrogen™ Rabbit anti-Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Alexa Fluor™ 633

Rabbit Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Mouse
Host Species	Rabbit
Conjugate	Alexa Fluor 633
Applications	Flow Cytometry,Immunohistochemistry,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	2 mg/mL
Antigen	Mouse IgG (H+L) Cross-Adsorbed
Regulatory Status	RUO
Purification Method	Purified
Product Type	Secondary Antibody
Formulation	PBS with 5mM sodium azide; pH 7.5
Immunogen	Gamma Immunoglobins Heavy and Light chains.
Classification	Polyclonal
Primary or Secondary	Secondary

1,977

Invitrogen™ GFP Polyclonal Antibody, Alexa Fluor™ 594

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Tag
Host Species	Rabbit
Conjugate	Alexa Fluor 594
Applications	Immunohistochemistry,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	2 mg/mL
Antigen	GFP
Regulatory Status	RUO
Purification Method	Ion-exchange chromatography
Gene Alias	GFP; GFP tag; GFP2; green fluorescence; green fluorescent; Turbo eGFP
Product Type	Antibody
Formulation	PBS with 5mM sodium azide; pH 7.5
Immunogen	The GFP was isolated directly from the jellyfish Aequorea victoria.
Classification	Polyclonal
Primary or Secondary	Primary

1,978

Invitrogen™ alpha Tubulin Monoclonal Antibody (236-10501), Biotin

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Bovine
Host Species	Mouse
Conjugate	Biotin
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	A6NHL2, P05213, P0DPH7, P68363, P68366, P68368, P68369, P68373, P81947, P81948, Q32KN8, Q3UX10, Q3ZCJ7, Q6B856, Q6PEY2, Q71U36, Q9BQE3, Q9BVA1, Q9CWF2
Isotype	IgG1
Antigen	alpha Tubulin
Gene Symbols	Tuba1a, Tuba1b, TUBA1C, TUBA3C, TUBA3E, TUBA4A, TUBAL3, TUBB2B
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	1t; a1t; ALPHA 84C; alpha tubulin; alpha tubulin 84B; alpha[[1]] tubulin; alpha[[1]]-tubulin; alpha1; alpha1 tubulin; alpha1t; alpha1tub; alpha1tub84B; alpha1-tubulin; alpha84B; alphaT; alphat-1; alphatub; alpha-tub; alphaTub1; alphatub84; alphaTUB84B; alpha-tub84B; alphaTub84B-PA; alphatubulin; alpha-tubulin; Alpha-tubulin 1; Alpha-tubulin 2; Alpha-tubulin 3; Alpha-tubulin 3C; alpha-tubulin 3C/D; Alpha-tubulin 3D; Alpha-tubulin 3E; alpha-tubulin 4; Alpha-tubulin 6; alphaTubulin 84B; alpha-tubulin 84B; alpha-Tubulin at 84B; alpha-tubulin I; Alpha-tubulin II; alpha-tubulin III; Alpha-tubulin isotype M-alpha-1; alpha-tubulin isotype M-alpha-2; Alpha-tubulin isotype M-alpha-4; alpha-tubulin isotype M-alpha-6; alpha-tubulin TUB1; alpha-tubulin ubiquitous; alphaTubulin84B; Alpha-Tubulin84B; ALS22; anon-EST:Liang-1.59; anon-EST:Liang-2.30; AT25469p; aTub84B; a-tub84B; bA408E5.3; B-ALPHA-1; bcm948; BEST:LD32507; cb944; CG1913; CG1913-PA; chr3R:2914276..2914416; clone 1.59; clone 2.30; Detyrosinated tubulin alpha-1A chain; Detyrosinated tubulin alpha-1B chain; Detyrosinated tubulin alpha-1C chain; Detyrosinated tubulin alpha-3 chain; Detyrosinated tubulin alpha-3C chain; Detyrosinated tubulin alpha-3D chain; Detyrosinated tubulin alpha-3E chain; DM1alpha; Dmel\CG1913; Dmel_CG1913; DTA1; fb22g06; FLJ30169; H2 ALPHA; H2-ALPHA; hum-a-tub1; hum-a-tub2; I79_019110; K-ALPHA-1; l(3)84Bd; l(3)g3; lis3; LOC100726777; LOC100731885; LOC100857858; LOC101118307; LOC106557476; M[a]4; M[a]6; ms(3)nc33; nc33; RGD1565476; similar to alpha-tubulin isoform 1; similar to tubulin alpha 1; T; Talpha1; Talpha1 alpha-tubulin; TBA1_DROME; Testis-specific alpha-tubulin; Tub; Tub 84B; TUB1; Tub1C; Tub84B; TUBA1; Tuba-1; tuba1 protein; TUBA1/3/4; Tuba1a; tuba1a.L; tuba1a-a; tuba1a-b; TUBA1B; TUBA1C; tuba1l; tuba1l2; TUBA2; TUBA3; TUBA3C; TUBA3D; TUBA3E; Tuba4; Tuba4a; TUBA5; Tuba6; tuba8.S; tubA84B; tubal2; Tubalpha1; tubulin; tubulin 1 alpha-chain; tubulin 1alpha; tubulin alpha; tubulin alpha 1a; tubulin alpha 1a L homeolog; tubulin alpha 1b; tubulin alpha 1c; tubulin alpha 3; tubulin alpha 3c; tubulin alpha 3e; tubulin alpha 4a; tubulin alpha 6; tubulin alpha 8 S homeolog; tubulin alpha1; tubulin alpha-1 chain; tubulin alpha1 promoter; Tubulin alpha-1A chain; tubulin alpha-1B chain; Tubulin alpha-1C chain; tubulin alpha-1C chain-like; tubulin alpha-2 chain; Tubulin alpha-3 chain; Tubulin alpha-3C chain; tubulin alpha-3C/D chain; Tubulin alpha-3D chain; Tubulin alpha-3E chain; tubulin alpha-4 chain; Tubulin alpha-4A chain; Tubulin alpha-5 chain; tubulin alpha-5 chain-like; tubulin alpha-6 chain; tubulin alpha-8 chain; tubulin alpha-ubiquitous chain; tubulin B-alpha-1; Tubulin H2-alpha; tubulin K-alpha-1; tubulin(alpha1); tubulin, alpha 1; tubulin, alpha 1 (testis specific); tubulin, alpha 1, like; tubulin, alpha 1, like 2; tubulin, alpha 1a; tubulin, alpha 1b; tubulin, alpha 1c; tubulin, alpha 2; tubulin, alpha 3c; tubulin, alpha 3e; tubulin, alpha 4; tubulin, alpha 4a; tubulin, alpha 5; tubulin, alpha 6; tubulin, alpha, brain-specific; tubulin, alpha, ubiquitous; tubulin1alpha; tubulin84B; Tubulin-alpha1; Unknown (protein for MGC:133894); unnamed protein product; wu:fb22g06; wu:fb37a10; XELAEV_18019849mg; XELAEV_18020901mg; YML085C
Gene	TUBAL3
Product Type	Antibody
Gene ID (Entrez)	10376, 112714, 22142, 22143, 22145, 22146, 238463, 281555, 347733, 404053, 504244, 534900, 538631, 539882, 7277, 7278, 73710, 777775, 7846, 79861, 84790
Formulation	PBS with no preservative
Immunogen	Bovine Alpha-Tubulin.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	236-10501

1,979

Invitrogen™ Rabbit anti-Goat IgG (H+L) Cross-Adsorbed Secondary Antibody, Alexa Fluor™ 555

Rabbit Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Goat
Host Species	Rabbit
Conjugate	Alexa Fluor 555
Applications	Immunohistochemistry,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	2 mg/mL
Antigen	Goat IgG (H+L) Cross-Adsorbed
Regulatory Status	RUO
Purification Method	Purified
Product Type	Secondary Antibody
Formulation	PBS with 5mM sodium azide; pH 7.5
Immunogen	Gamma Immunoglobins Heavy and Light chains.
Classification	Polyclonal
Primary or Secondary	Secondary

1,980

Invitrogen™ CD41 Monoclonal Antibody (MEM-06), Alexa Fluor™ 700

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor 700
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P08514
Isotype	IgG1
Concentration	0.08 mg/mL
Antigen	CD41
Gene Symbols	Itga2b
Regulatory Status	RUO
Purification Method	Size-exclusion chromatography
Gene Alias	AI172977; alpha IIb; alphaIIb; alphaIIb protein; BDPLT16; BDPLT2; CD41; CD41B; form 1; form 2; GP IIb; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; integrin alpha 2b; integrin alpha 2b (Cd41b); integrin alpha-IIb; Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2; integrin subunit alpha 2b; integrin subunit alpha IIb; integrin, alpha 2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb; platelet glycoprotein IIb of IIb/II Ia complex; platelet glycoprotein IIb of IIb/IIIa complex; platelet membrane glycoprotein IIb; platelet-specific antigen BAK; PPP1R93; protein phosphatase 1, regulatory subunit 93
Gene	Itga2b
Product Type	Antibody
Gene ID (Entrez)	3674
Formulation	PBS with 0.2% BSA and 15mM sodium azide
Immunogen	Leukocytes, LGL-type leukaemia.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MEM-06

Antibodies

Filtered Search Results

Narrow Results

CD279 (PD-1) Monoclonal Antibody (RMP1-30), PE, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Coramitug Chimeric Recombinant Human Monoclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SNAP25 Monoclonal Antibody (SP12), Biotin Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD3 Monoclonal Antibody (SK7), PerCP-eFluor™ 710, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Nur77 Monoclonal Antibody (12.14), eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ IL-17A Monoclonal Antibody (41809) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CXCL13 Monoclonal Antibody (53610) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GP130 Monoclonal Antibody (125623) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD154 (CD40 Ligand) Monoclonal Antibody (MR1), APC, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TGFBR2 Monoclonal Antibody (2F11) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GFP Polyclonal Antibody, Alexa Fluor™ 594 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ alpha Tubulin Monoclonal Antibody (236-10501), Biotin Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD41 Monoclonal Antibody (MEM-06), Alexa Fluor™ 700 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD279 (PD-1) Monoclonal Antibody (RMP1-30), PE, eBioscience™, Invitrogen™

Invitrogen™ Coramitug Chimeric Recombinant Human Monoclonal Antibody

Invitrogen™ SNAP25 Monoclonal Antibody (SP12), Biotin

Invitrogen™ CD3 Monoclonal Antibody (SK7), PerCP-eFluor™ 710, eBioscience™

Invitrogen™ Nur77 Monoclonal Antibody (12.14), eBioscience™

Invitrogen™ IL-17A Monoclonal Antibody (41809)

Invitrogen™ CXCL13 Monoclonal Antibody (53610)

Invitrogen™ GP130 Monoclonal Antibody (125623)

CD154 (CD40 Ligand) Monoclonal Antibody (MR1), APC, eBioscience™, Invitrogen™

Invitrogen™ TGFBR2 Monoclonal Antibody (2F11)

Invitrogen™ GFP Polyclonal Antibody, Alexa Fluor™ 594

Invitrogen™ alpha Tubulin Monoclonal Antibody (236-10501), Biotin

Invitrogen™ CD41 Monoclonal Antibody (MEM-06), Alexa Fluor™ 700