Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ TGFBR2 Monoclonal Antibody (2F11)
GREENER_CHOICE

Catalog No. PIMA549166 Shop All Thermo Scientific Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIMA549166 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIMA549166 Supplier Invitrogen™ Supplier No. MA549166
Add to Cart
Edge
Add to Cart

Mouse Monoclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids. Positive Control - WB: human HepG2 whole cell, human A549 whole cell, human K562 whole cell, human Caco-2 whole cell, human Hela whole cell, human T-47D whole cell. IHC: human placenta tissue, human cervical intraepithelial neoplasia tissue, human esophageal squamous carcinoma tissue. ICC/IF: HepG2 cell. Flow: A549 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Transforming Growth Factor, beta receptor 2 (AAT3, FAA3, MFS2, RIIC, LDS1B, LDS2B, TAAD2, TGFR-2, TGFbeta-RII) is a member of the TGF-beta family of receptor Serine/Threonine kinases. It is involved in the regulation of cell proliferation. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). TGFBR2 encodes the gamma subunit of the catalytic core. Alternatively spliced transcript variants encoding different isoforms have been identified. TGFBR2 also has a pseudogene on chromosome 14.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TGFBR2
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Monoclonal
Clone 2F11
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene TGFBR2
Gene Accession No. P37173
Gene Alias 1110020H15Rik; AAT3; AU042018; DNIIR; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; RIIDN; TAAD2; TbetaRII; TbetaR-II; TBR-II; tgf beta receptor 2; TGF-beta 2; TGF-beta receptor II; TGF-beta receptor type II; TGF-beta receptor type IIB; TGF-beta receptor type-2; TGFbeta RII; TGFbeta type II receptor; TGF-beta type II receptor; TGFbeta-RII; TGFBR2; Tgfbr2T; TGFR2; TGFR-2; transforming growth factor beta receptor 2; transforming growth factor beta receptor II; transforming growth factor beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor 2; transforming growth factor, beta receptor II; transforming growth factor, beta receptor II (70/80kDa); transforming growth factor, beta receptor II alpha; transforming growth factor, beta receptor II beta; transforming growth factor, beta receptor II delta; transforming growth factor, beta receptor II epsilon; transforming growth factor, beta receptor II gamma; transforming growth factor, beta receptor IIT; transforming growth factor-b type II receptor; transforming growth factor-beta receptor type II; transforming growth factor-beta type II receptor
Gene Symbols TGFBR2
Host Species Mouse
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7048
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.