Invitrogen™ TGFBR2 Monoclonal Antibody (2F11)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA549166

Catalog No. PIMA549166

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids. Positive Control - WB: human HepG2 whole cell, human A549 whole cell, human K562 whole cell, human Caco-2 whole cell, human Hela whole cell, human T-47D whole cell. IHC: human placenta tissue, human cervical intraepithelial neoplasia tissue, human esophageal squamous carcinoma tissue. ICC/IF: HepG2 cell. Flow: A549 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Transforming Growth Factor, beta receptor 2 (AAT3, FAA3, MFS2, RIIC, LDS1B, LDS2B, TAAD2, TGFR-2, TGFbeta-RII) is a member of the TGF-beta family of receptor Serine/Threonine kinases. It is involved in the regulation of cell proliferation. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). TGFBR2 encodes the gamma subunit of the catalytic core. Alternatively spliced transcript variants encoding different isoforms have been identified. TGFBR2 also has a pseudogene on chromosome 14.

Specifications

• Antigen: TGFBR2
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P37173
• Gene Symbols: TGFBR2
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Clone: 2F11
• Conjugate: Unconjugated
• Gene: TGFBR2
• Gene Alias: 1110020H15Rik; AAT3; AU042018; DNIIR; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; RIIDN; TAAD2; TbetaRII; TbetaR-II; TBR-II; tgf beta receptor 2; TGF-beta 2; TGF-beta receptor II; TGF-beta receptor type II; TGF-beta receptor type IIB; TGF-beta receptor type-2; TGFbeta RII; TGFbeta type II receptor; TGF-beta type II receptor; TGFbeta-RII; TGFBR2; Tgfbr2T; TGFR2; TGFR-2; transforming growth factor beta receptor 2; transforming growth factor beta receptor II; transforming growth factor beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor 2; transforming growth factor, beta receptor II; transforming growth factor, beta receptor II (70/80kDa); transforming growth factor, beta receptor II alpha; transforming growth factor, beta receptor II beta; transforming growth factor, beta receptor II delta; transforming growth factor, beta receptor II epsilon; transforming growth factor, beta receptor II gamma; transforming growth factor, beta receptor IIT; transforming growth factor-b type II receptor; transforming growth factor-beta receptor type II; transforming growth factor-beta type II receptor
• Host Species: Mouse
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 7048
• Content And Storage: -20°C
• Form: Lyophilized