Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

376 – 390 of 1,493,326 results

376

Invitrogen™ GRP78 Polyclonal Antibody, Alexa Fluor™ 647

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Alexa Fluor 647
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	P06761, P11021, P20029
Isotype	IgG
Concentration	1 mg/mL
Antigen	GRP78
Gene Symbols	Hspa5
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	78 kDa glucose-regulated protein; 78 kDa glucose-regulated protein homolog; 78-kD glucose-regulated protein precursor; AL022860; AU019543; baffled; Binding-immunoglobulin protein; bip; BiP protein; BiP/Grp78; cb865; D2Wsu141e; D2Wsu17e; Endoplasmic reticulum chaperone BiP; endoplasmic reticulum chaperone BiP; 78 kDa glucose-regulated protein; endoplasmic reticulum lumenal Ca(2+)-binding protein grp78; epididymis secretory sperm binding protein Li 89n; fb60h09; fi36d04; FLJ26106; glucose regulated protein, 78 kDa; glucose-regulated protein; glucose-regulated protein, 78kDa; GRP 78; grp78; GRP-78; heat shock 70 kDa protein 5; heat shock 70 kDa protein 5a; heat shock 70kD protein 5; heat shock 70kD protein 5 (glucose-regulated protein, 78kD); heat shock 70kDa protein 5; heat shock 70kDa protein 5 (glucose-regulated protein); heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa); heat shock protein 5; heat shock protein 70 family protein 5; heat shock protein family A (Hsp70) member 5; heat shock protein family A (Hsp70) member 5 L homeolog; heat shock protein family A member 5; heavy-chain binding protein BiP; HEL-S-89n; Hsce70; hsp70; Hsp70 family ATPase KAR2; HSP70 family protein 5; HSPA 5; HSPA5; hspa5.L; hspa5a; I79_019946; immunoglobulin binding protein; immunoglobulin heavy chain-binding protein; Immunoglobulin heavy chain-binding protein homolog; J1248; KAR2; mBiP; MIF2; Sez7; SEZ-7; SSD1; Steroidogenesis-activator polypeptide; wu:fb60h09; wu:fi36d04; XAP-1; XAP-1 antigen; XELAEV_180384511mg; YJL034W; zgc:55994; zgc:77606
Gene	Hspa5
Product Type	Antibody
Gene ID (Entrez)	14828, 25617, 3309
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide corresponding to residues C T(643) G E E D T S E K D E L(654) of rat GRP78.
Classification	Polyclonal
Primary or Secondary	Primary

377

Invitrogen™ RAB11A Monoclonal Antibody (4H9)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	P62491, P62492, P62494
Isotype	IgG2b
Concentration	500 μg/mL
Antigen	RAB11A
Gene Symbols	RAB11A
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	24KG; RAB 11A, member oncogene family; RAB11; rab-11; rab11 GTP-binding protein; Rab11a; RAB11a, member RAS oncogene family; ras-related protein Rab-11A; tubulovesicle-associated protein; YL8
Gene	RAB11A
Product Type	Antibody
Gene ID (Entrez)	53869, 81830, 8766
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	4H9

378

Invitrogen™ FOXP3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ChIP Assay,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q9BZS1
Isotype	IgG
Concentration	1 mg/mL
Antigen	FOXP3
Gene Symbols	Foxp3
Regulatory Status	RUO
Purification Method	Antigen Affinity Chromatography
Gene Alias	AIID; DIETER; forkhead box P3; forkhead box protein P3; Forkhead box protein P3 41 kDa form; Forkhead box protein P3, C-terminally processed; forkhead/winged helix transcription factor 3; Foxp3; FOXP3delta7; immune dysregulation, polyendocrinopathy, enteropathy, X-linked; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; IPEX; JM2; MGC141961; MGC141963; PIDX; regulatory protein Foxp3; RGD1562112; RP23-54C14.1; scurfin; scurfy; sf; XPID
Gene	Foxp3
Product Type	Antibody
Gene ID (Entrez)	50943
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues W(406) T V D E L E F R K K R S Q R(420) of human FOXP3.
Classification	Polyclonal
Primary or Secondary	Primary

379

Invitrogen™ GATA4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P43694, Q08369
Isotype	IgG
Concentration	1 mg/mL
Antigen	GATA4
Gene Symbols	GATA4
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	ASD2; DNA-binding protein GATA-GT2; GAT4; GATA binding protein 4; GATA4; Gata-4; GATA-binding factor 4; GATA-binding protein 4; MGC126629; TACHD; TOF; Transcription factor GATA-4; VSD1
Gene	GATA4
Product Type	Antibody
Gene ID (Entrez)	14463, 2626
Formulation	PBS with 30% glycerol, 1mg/mL BSA and 0.05% sodium azide
Immunogen	Pooled peptides: RKEGIQTRKRKPKNLNKSK & SKQDSWNSLVLADSHGDIITA.
Classification	Polyclonal
Primary or Secondary	Primary

380

Invitrogen™ GM130 Polyclonal Antibody, Alexa Fluor™ 647

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Rabbit
Conjugate	Alexa Fluor 647
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	Q08379
Isotype	IgG
Concentration	1 mg/mL
Antigen	GM130
Gene Symbols	Golga2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	130 kDa cis-Golgi matrix protein; AW555139; cis-Golgi matrix protein GM130; Gm130; GM130 autoantigen; GOLGA2; golgi autoantigen, golgin subfamily a, 2; Golgi matrix protein GM130; golgin A2; Golgin subfamily A member 2; Golgin subfamily A member 2; LOW QUALITY PROTEIN: golgin subfamily A member 2; golgin-95; mKIAA4150; RP11-395P17.5; SY11 protein
Gene	Golga2
Product Type	Antibody
Gene ID (Entrez)	2801
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide corresponding to residues G(368) Q V M E S V R Q L Q M E R D K(383) of human GM130.
Classification	Polyclonal
Primary or Secondary	Primary

381

Invitrogen™ GAPDH Loading Control Monoclonal Antibody (GA1R), Alexa Fluor™ 555

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Bacteria,Chicken,Hamster,Human,Insect,Mouse,Rabbit,Rat,Yeast
Host Species	Mouse
Conjugate	Alexa Fluor 555
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O14556, P00356, P04406, P04797, P16858, P17244, P46406, Q64467, Q9ESV6
Isotype	IgG1
Concentration	1 mg/mL
Antigen	GAPDH Loading Control
Gene Symbols	GAPDH, GAPDHS
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	38 kDa BFA-dependent ADP-ribosylation substrate; aging-associated gene 9 protein; BARS-38; bb02e05; cb350; cb609; CDABP0047; EC 1.2.1.12; epididymis secretory protein Li 278; epididymis secretory sperm binding protein Li 162eP; fb71f08; fk58c09; G3PD; G3PDH; GAPD; GAPD2; gapdh; GAPDH2; GAPDH-2; GAPDHS; Gapds; Gapd-s; glceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase, testis-specific; glyceraldehyde phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase (G3PDH); glyceraldehyde-3-phosphate dehydrogenase 2; glyceraldehyde-3-phosphate dehydrogenase GAPDH; glyceraldehyde-3-phosphate dehydrogenase like-17 protein; glyceraldehyde-3-phosphate dehydrogenase type 2; glyceraldehyde-3-phosphate dehydrogenase, spermatogenic; glyceraldehyde-3-phosphate dehydrogenase, testis-specific; glyceraldehyde-phosphate-dehydrogenase; glycerine aldehyde 3-phosphate dehydrogenase; HEL-S-162eP; HEL-S-278; HGNC:4141; HSD35; HSD-35; I79_001391; KNC-NDS6; LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase, testis-specific; mg:bb02e05; MGC128279 protein; MGC88685; multifunctional protein, glycolytic enzyme; OK/SW-cl.12; Peptidyl-cysteine S-nitrosylase GAPDH; similar to glyceraldehyde 3-phosphate dehydrogenase; spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2; Spermatogenic glyceraldehyde-3-phosphate dehydrogenase; Unknown (protein for IMAGE:8101613); unnamed protein product; wu:fb33a10; wu:fb71f08; wu:fk58c09; wu:ft80f05; zgc:76908
Gene	GAPDHS
Product Type	Antibody
Gene ID (Entrez)	100009074, 100352213, 100736557, 100767862, 14433, 14447, 24383, 2597, 26330, 374193, 66020
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	recombinant GAPDH.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	GA1R

382

Invitrogen™ Goat anti-Mouse IgG (H+L) Secondary Antibody, DyLight™ 405

Goat Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Goat
Conjugate	DyLight 405
Applications	Flow Cytometry,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	1 mg/mL
Antigen	Mouse IgG (H+L)
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with 1% BSA and 0.02% sodium azide; pH 7.2
Immunogen	Purified Mouse IgG, whole molecule.
Classification	Polyclonal
Primary or Secondary	Secondary

383

Invitrogen™ Goat anti-Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, DyLight™ 405

Goat Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Goat
Conjugate	DyLight 405
Applications	Flow Cytometry,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	1 mg/mL
Antigen	Mouse IgG (H+L) Cross-Adsorbed
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with 0.02% sodium azide; pH 7.2
Classification	Polyclonal
Primary or Secondary	Secondary

384

Invitrogen™ EEF2 Monoclonal Antibody (5B6)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P13639, P58252
Isotype	IgG1
Concentration	Conc. Not Determined
Antigen	EEF2
Gene Symbols	EEF2
Regulatory Status	RUO
Gene Alias	EEF2; EEF-2; Ef2; EF-2; Elongation factor 2; elongation factor-2; eukaryotic translation elongation factor 2; I79_013848; polypeptidyl-tRNA translocase; SCA26; zef2
Gene	EEF2
Product Type	Antibody
Gene ID (Entrez)	13629, 1938
Formulation	ascites with 0.03% sodium azide
Immunogen	Purified recombinant fragment of human EEF2 expressed in E. Coli.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	5B6

385

Invitrogen™ TCF7 Monoclonal Antibody (C.725.7)

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P36402, Q00417
Isotype	IgG
Concentration	100 μg/mL
Antigen	TCF7
Gene Symbols	TCF7
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI465550; HMG-box; OTTHUMP00000159390; OTTHUMP00000159391; T cell factor-1; T-cell factor 1; T-cell specific; T-cell-specific transcription factor 1; Tcf1; TCF-1; Tcf7; TCF-7; Transcription factor 7; transcription factor 7 (T-cell specific, HMG-box); transcription factor 7, T cell specific; transcription factor 7, T-cell specific
Gene	TCF7
Product Type	Antibody
Gene ID (Entrez)	21414, 6932
Formulation	0.01M HEPES with 0.15M NaCl, 50% glycerol, 100 μg/mL BSA and <0.02% sodium azide, pH 7.5
Immunogen	Synthetic peptide corresponding to a region surrounding Pro96 of human TCF1 protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	C.725.7

386

Invitrogen™ SNAIL Monoclonal Antibody (F.31.8)

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Monkey,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O95863, Q02085
Isotype	IgG
Concentration	110 μg/mL
Antigen	SNAIL
Gene Symbols	Snai1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI194338; dJ710H13.1; Protein sna; protein snail homolog 1; SLUGH2; SNA; Sna protein; Sna1; SNAH; snai; SNAI1; Snail; snail 1; snail 1 homolog; snail 1 zinc finger protein; snail 1, zinc finger protein; snail family transcriptional repressor 1; snail family zinc finger 1; snail homolog 1; Snail1; Zinc finger protein SNAI1
Gene	Snai1
Product Type	Antibody
Gene ID (Entrez)	116490, 20613, 6615
Formulation	0.01M HEPES with 50% glycerol, 0.15M NaCl, 100 μg/mL BSA and <0.02% sodium azide, pH 7.5
Immunogen	Recombinant human Snail protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	F.31.8

387

Invitrogen™ Phospho-RNA pol II CTD (Ser2) Monoclonal Antibody

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C or -80°C if preferred
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	ChIP Assay,ChIP sequencing (ChIP-seq),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P24928
Isotype	IgG1
Concentration	1 mg/mL
Antigen	Phospho-RNA pol II CTD (Ser2)
Gene Symbols	POLR2A
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	220kDa; AW321876; DNA polymerase alpha 1 catalytic subunit; DNA polymerase alpha 1, 180 kDa; DNA polymerase alpha 1, catalytic subunit; DNA polymerase alpha catalytic subunit; DNA polymerase alpha catalytic subunit p180; DNA polymerase alpha p180 subunit; DNA polymerase alpha subunit I; DNA polymerase epsilon catalytic subunit; DNA polymerase epsilon catalytic subunit A; DNA polymerase II subunit A; DNA-directed RNA polymerase II largest subunit, RNA polymerase II 220 kd subunit; DNA-directed RNA polymerase II subunit A; DNA-directed RNA polymerase II subunit RPB1; DNA-directed RNA polymerase III largest subunit; DUN2; EC 2.7.7.6; G7a/Bat6Hom; hRPB220; hsRPB1; I79_002751; I79_016081; MGC75453; N0825; NSX; p180; Pol II S2p; POL2; Pola; Pola1; POLR2; POLR2A; POLRA; polymerase (DNA directed), alpha 1; polymerase (DNA directed), alpha 1, catalytic subunit; polymerase (DNA) alpha 1, catalytic subunit; polymerase (DNA-directed), alpha (70kD); Polymerase (RNA II (DNA directed), large polypeptide; polymerase (RNA) II (DNA directed) polypeptide A; polymerase (RNA) II (DNA directed) polypeptide A, 220kDa; polymerase (RNA) II subunit A; POLYMERASE II; polymerase, alpha 1; RNA; RNA POL2; RNA polymerase II 1; RNA polymerase II carboxy-terminal domain; RNA polymerase II C-terminal domain; RNA polymerase II largest subunit; RNA polymerase II subunit A; RNA polymerase II subunit B1; RNA-directed RNA polymerase II subunit RPB1; RP02; Rpb1; RPB220; RPBh1; Rpii215; RpIILS; RPO2; RPO21; Rpo2-1; RPOL2; SUA8; YNL262W
Gene	POLR2A
Product Type	Antibody
Gene ID (Entrez)	5430
Formulation	PBS with 0.05% sodium azide; pH 7.4
Immunogen	Human YSPTSPS repeat in the B1 subunit of RNA polymerase II, phosphorylated at Ser2 of the repeat sequence.
Classification	Monoclonal
Primary or Secondary	Primary

388

Invitrogen™ Ty1 Tag Monoclonal Antibody (BB2)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C or -80°C if preferred
Target Species	Tag
Host Species	Mouse
Conjugate	Unconjugated
Applications	ChIP Assay,Western Blot
Form	Liquid
Isotype	IgG1
Concentration	1.9 mg/mL
Antigen	Ty1 Tag
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	Ty1 Epitope Tag
Product Type	Antibody
Formulation	PBS with 0.05% sodium azide; pH 7.4
Immunogen	Ty1 tag (amino acid sequence EVHTNQDPLD).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	BB2

389

Invitrogen™ CSP alpha Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P60904, P60905, Q9H3Z4
Isotype	IgG
Concentration	1 mg/mL
Antigen	CSP alpha
Gene Symbols	Dnajc5
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	2610314I24Rik; AU018536; Ceroid-lipofuscinosis neuronal protein 4; CLN4; CLN4B; Csp; CSP alpha; cysteine string protein; cysteine string protein alpha; DnaJ (Hsp40) homolog, subfamily C, member 5; DnaJ heat shock protein family (Hsp40) member C5; dnaJ homolog subfamily C member 5; Dnajc5; DNAJC5A; mir-941-2; mir-941-3; mir-941-4; mir-941-5; NCL
Gene	Dnajc5
Product Type	Antibody
Gene ID (Entrez)	13002, 79130, 80331
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues E(180) T T Q L T A D S H P S Y H T D G F N(198) of rat CSP.
Classification	Polyclonal
Primary or Secondary	Primary

390

Invitrogen™ CD163 Monoclonal Antibody (eBioGHI/61 (GHI/61)), Brilliant Violet™ 711, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Violet 711
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q86VB7
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD163
Gene Symbols	CD163
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD163; CD163 antigen; CD163 molecule; CD163v2; CD163v3; Hemoglobin scavenger receptor; M130; macrophage-associated antigen; MM130; putative CD163 antigen; SCARI1; Scavenger receptor cysteine-rich type 1 protein M130; sCD163; Soluble CD163; Soluble sCD163
Gene	CD163
Product Type	Antibody
Gene ID (Entrez)	9332
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBioGHI/61 (GHI/61)

Prev
1
...
24
25
26
27
...
99,556
Next

Welcome to fishersci.com

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ GRP78 Polyclonal Antibody, Alexa Fluor™ 647 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ RAB11A Monoclonal Antibody (4H9) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ FOXP3 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GATA4 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GM130 Polyclonal Antibody, Alexa Fluor™ 647 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GAPDH Loading Control Monoclonal Antibody (GA1R), Alexa Fluor™ 555 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ EEF2 Monoclonal Antibody (5B6) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TCF7 Monoclonal Antibody (C.725.7) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SNAIL Monoclonal Antibody (F.31.8) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Ty1 Tag Monoclonal Antibody (BB2) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CSP alpha Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD163 Monoclonal Antibody (eBioGHI/61 (GHI/61)), Brilliant Violet™ 711, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GRP78 Polyclonal Antibody, Alexa Fluor™ 647

Invitrogen™ RAB11A Monoclonal Antibody (4H9)

Invitrogen™ FOXP3 Polyclonal Antibody

Invitrogen™ GATA4 Polyclonal Antibody

Invitrogen™ GM130 Polyclonal Antibody, Alexa Fluor™ 647

Invitrogen™ GAPDH Loading Control Monoclonal Antibody (GA1R), Alexa Fluor™ 555

Invitrogen™ EEF2 Monoclonal Antibody (5B6)

Invitrogen™ TCF7 Monoclonal Antibody (C.725.7)

Invitrogen™ SNAIL Monoclonal Antibody (F.31.8)

Invitrogen™ Ty1 Tag Monoclonal Antibody (BB2)

Invitrogen™ CSP alpha Polyclonal Antibody

Invitrogen™ CD163 Monoclonal Antibody (eBioGHI/61 (GHI/61)), Brilliant Violet™ 711, eBioscience™