Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

481 – 495 of 1,659,610 results

481

Invitrogen™ Ly-6E Recombinant Rabbit Monoclonal Antibody (HL1933)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q16553
Isotype	IgG
Concentration	1 mg/mL
Antigen	Ly-6E
Gene Symbols	LY6E
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	9804; locus A/E; Locus AE; Ly67; Ly6A; Ly6e; ly-6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; retinoic acid induced gene E; retinoic acid-induced gene E protein; RIGE; RIG-E; SCA2; SCA-2; Stem cell antigen 2; thymic shared antigen 1; Tsa1; Tsa-1
Gene	LY6E
Product Type	Antibody
Gene ID (Entrez)	4061
Formulation	PBS with no preservative
Immunogen	Recombinant fragment of human LY6E.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HL1933

482

Invitrogen™ CYP27B1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O15528, O35084, O35132
Isotype	IgG
Concentration	500 μg/mL
Antigen	CYP27B1
Gene Symbols	CYP27B1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1alpha(OH)ase; 25 hydroxyvitamin D3-1-alpha hydroxylase; 25(OH)D 1alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha); 25-hydroxyvitamin D3 1alpha-hydroxylase; 25-OHD-1 alpha-hydroxylase; Calcidiol 1-monooxygenase; Cp2b; cy; Cyp1; CYP1alpha; Cyp27b; Cyp27b1; Cyp40; cytochrome p450 27B1; cytochrome P450 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450 family 27 subfamily B member 1; cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1; cytochrome P450 subfamily XXVIIB polypeptide 1; cytochrome P450, 27b1; cytochrome P450, 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450, family 27, subfamily B, polypeptide 1; cytochrome P450, subfamily 27b, polypeptide 1; cytochrome P450C1 alpha; Cytochrome P450VD1-alpha; P450c1; P450C1 alpha; P450VD1alpha; P450VD1-alpha; Pddr; VD3 1A hydroxylase; Vdd1; Vddr; VDDRI; VDR
Gene	CYP27B1
Product Type	Antibody
Gene ID (Entrez)	114700, 13115, 1594
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR).
Classification	Polyclonal
Primary or Secondary	Primary

483

Invitrogen™ Transferrin Receptor Monoclonal Antibody (MEM-75), PE

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P02786
Isotype	IgG1 κ
Concentration	0.055 mg/mL
Antigen	Transferrin Receptor
Gene Symbols	TFRC
Regulatory Status	RUO
Purification Method	Size-exclusion chromatography
Gene Alias	2610028K12Rik; AI195355; AI426448; AU015758; CD antigen CD71; CD71; chicken transferrin receptor; E430033M20Rik; I79_000642; IMD46; mammary tumor virus receptor 1; Mtvr1; Mtvr-1; p90; sTfR; T9; TfR; tfR1; TFR2; TFRC; TR; transferrin receptor; transferrin receptor (p90, CD71); transferrin receptor 2; transferrin receptor protein 1; Transferrin receptor protein 1, serum form; Trfr
Gene	TFRC
Product Type	Antibody
Gene ID (Entrez)	7037
Formulation	PBS with 0.2% BSA and 15mM sodium azide; pH 7.4
Immunogen	Pre-B cell line NALM-6.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MEM-75

484

Invitrogen™ TBP Monoclonal Antibody (3TF1-3G3)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Canine,Monkey
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P20226, P29037
Isotype	IgG1 κ
Concentration	Conc. Not Determined
Antigen	TBP
Gene Symbols	Tbp
Regulatory Status	RUO
Gene Alias	Gtf2d; GTF2D1; HDL4; MGC117320; MGC126054; MGC126055; RP1-191N21.3; SCA17; TATA binding protein; TA-TA binding protein 1; TATA box binding protein; TATA sequence-binding protein; TATA-binding factor; TATA-binding protein; TATA-box binding protein; TATA-box binding protein N-terminal domain; TATA-box factor; tata-box-binding; TATA-box-binding protein; TBP; TBP0; TBP1; TF2D; TFIID; TFIID core protein; transcription initiation factor TFIID TBP subunit; Unknown (protein for MGC:138100)
Gene	Tbp
Product Type	Antibody
Gene ID (Entrez)	21374, 611193, 6908
Formulation	ascites with 0.05% sodium azide
Immunogen	Full length recombinant human TBP as a fusion protein. Epitope mapping showed that it recognizes the first 18aa of human TBP.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	3TF1-3G3

485

Invitrogen™ POLR3F Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2°C to 8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot
Form	Liquid
Gene Accession No.	Q921X6, Q9H1D9
Isotype	IgG
Concentration	1 mg/mL
Antigen	POLR3F
Gene Symbols	POLR3F
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	2810411G20Rik; 3010019O03Rik; 3110032A07Rik; DNA-directed RNA polymerase III subunit F; DNA-directed RNA polymerase III subunit RPC6; Polr3f; polymerase (RNA) III (DNA directed) polypeptide F; polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa; polymerase (RNA) III subunit F; RNA polymerase III 39 kDa subunit; RNA polymerase III C39 subunit; RNA polymerase III subunit C6; RNA polymerase III subunit F; RPC39; RPC6
Gene	POLR3F
Product Type	Antibody
Gene ID (Entrez)	10621, 311487, 70408
Formulation	PBS with 0.02% sodium azide
Immunogen	A 21 amino acid peptide from near the amino terminus of human POLR3F.
Classification	Polyclonal
Primary or Secondary	Primary

486

Invitrogen™ REG1A Monoclonal Antibody (1A4)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Immunocytochemistry
Form	Liquid
Gene Accession No.	P05451, P10758
Isotype	IgG1
Concentration	Conc. Not Determined
Antigen	REG1A
Gene Symbols	REG1A
Regulatory Status	RUO
Gene Alias	ICRF; islet cells regeneration factor; Islet of Langerhans regenerating protein; LITHOST; Lithostathine; lithostathine 1 alpha; lithostathine-1-alpha; MGC12447; P19; pancreatic stone protein; pancreatic stone protein, secretory; pancreatic thread protein; protein-X; PSP; PSPS; PSPS1; PTP; RATLITHOST; RATRGPI; Reg; Reg1; REG1A; REG-1-alpha; regenerating family member 1 alpha; regenerating islet-derived 1 alpha; regenerating islet-derived mouse homolog 1; regenerating islet-derived protein 1-alpha; Regenerating protein I alpha; regeneration protein, lithostatin, pancreatic stone protein; Rgp1; RGPI
Gene	REG1A
Product Type	Antibody
Gene ID (Entrez)	24714, 5967
Formulation	ascites with 0.03% sodium azide
Immunogen	Purified recombinant fragment of human REG1A fused with hIgGFc tag expressed in HEK293 cell line.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	1A4

487

Invitrogen™ Insulin Monoclonal Antibody (C7C9)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Bovine,Pig
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA
Form	Liquid
Gene Accession No.	P01308, P01315, P01317
Isotype	IgG1
Concentration	4.9 mg/mL
Antigen	Insulin
Gene Symbols	INS
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AA986540; IDDM; IDDM1; IDDM2; ILPR; INS; Ins1; Ins-1; Ins2; Ins-2; Ins2-rs1; InsII; Insulin; insulin 1; insulin 2; Insulin A chain; Insulin B chain; insulin I; insulin II; insulin-1; Insulin-1 A chain; Insulin-1 B chain; Insulin-2; Insulin-2 A chain; Insulin-2 B chain; IRDN; Mody; MODY10; Mody4; preproinsulin; proinsulin
Gene	INS
Product Type	Antibody
Gene ID (Entrez)	280829, 3630, 397415
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	Purified human Insulin.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	C7C9

488

Invitrogen™ KCNMB1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P97678, Q16558, Q8CAE3
Isotype	IgG
Concentration	1 mg/mL
Antigen	KCNMB1
Gene Symbols	KCNMB1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	big potassium channel beta subunit 1; BK channel beta subunit; BK channel beta subunit 1; BK channel subunit beta-1; BKbeta; BKbeta1; calcium-activated potassium channel beta subunit; calcium-activated potassium channel subunit beta; Calcium-activated potassium channel subunit beta-1; calcium-activated potassium channel, subfamily M subunit beta-1; Charybdotoxin receptor subunit beta-1; hbeta1; hslo-beta; K(VCA)beta; k(VCA)beta-1; Kcnmb1; large conductance Ca2+-activated K+ channel beta 1 subunit; maxi K channel subunit beta-1; MaxiK channel beta-subunit 1; potassium calcium-activated channel subfamily M regulatory beta subunit 1; potassium channel subfamily M regulatory beta subunit 1; potassium large conductance calcium-activated channel, subfamily M, beta member 1; slo-beta; slo-beta-1; slowpoke-beta
Gene	KCNMB1
Product Type	Antibody
Gene ID (Entrez)	16533, 29747, 3779
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic Peptide: L(90) Y H T E D T R D Q N Q Q C(103).
Classification	Polyclonal
Primary or Secondary	Primary

489

Invitrogen™ SHP2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	P35235, P41499, Q06124
Isotype	IgG
Concentration	500 μg/mL
Antigen	SHP2
Gene Symbols	PTPN11
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	2700084A17Rik; AW536184; bptp3; CFC; cSH-PTP2; encodes catalytic domain; HCP; HGNC:9644; JMML; METCDS; MGC14433; Noonan syndrome 1; ns1; null; OTTHUMP00000166108; phosphotyrosyl-protein phosphatase; protein tyrosine phosphatase non-receptor type 11; protein tyrosine phosphatase SH-PTP2; protein tyrosine phosphatase, non-receptor type 11; protein tyrosine phosphatase, non-receptor type 11 (Noonan syndrome 1); protein tyrosine phosphatase, non-receptor type 11 S homeolog; protein-tyrosine phosphatase 1D; Protein-tyrosine phosphatase 2C; protein-tyrosine phosphatase SYP; PTP1C; PTP1D; PTP-1D; ptp-2; PTP2C; PTP-2C; Ptpn11; ptpn11.S; ptpn11-a; ptpn11-b; SAP-2; SH2 domain-containing protein tyrosine phosphatase-2; Shp2; shp-2; SHPTP2; SH-PTP2; SH-PTP2 protein tyrosine phosphatase non-receptor type 11; SH-PTP2 protein tyrosine phosphatase, non-receptor type 11; SH-PTP3; Syp; Tyrosine-protein phosphatase non-receptor type 11; XELAEV_18010676mg
Gene	PTPN11
Product Type	Antibody
Gene ID (Entrez)	19247, 25622, 5781
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human SHP2 (582-597aa RVYENVGLMQQQKSFR).
Classification	Polyclonal
Primary or Secondary	Primary

490

Invitrogen™ H2BK5ac Recombinant Superclonal™ Antibody (24HCLC)

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Peptide Array,ChIP Assay,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	A0A2R8Y619, O60814, P06899, P0C1H6, P23527, P33778, P57053, P58876, P62807, Q16778, Q5QNW6, Q7Z2G1, Q8N257, Q93079, Q96A08, Q99877, Q99879, Q99880
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	H2BK5ac
Gene Symbols	H2B, H2bc1, H2BC10, H2BC11, H2BC12, H2BC13, H2BC14, H2BC15, H2BC17, H2bc18, H2BC21, H2BC3, H2BC4, H2BC5, H2BC8, H2BC9, H2BE1, H2BU1, H2BW1, H2BW2, LOC102724334
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	2610022J01Rik; Acetyl-Histone H2; Acetyl-Histone H2B K5; Acetyl-Histone H2B Lys5; AV127319; bA317E16.3; dJ160A22.3; dJ193B12.2; dJ221C16.3; dJ221C16.6; dJ221C16.8; dJ97D16.4; GL105; H2B; H2B 291A; H2B 291B; H2b 613; H2B GL105; H2B histone family member M; H2B histone family member W testis-specific; H2B histone family member W, testis specific; H2B histone family, member A; H2B histone family, member B; H2B histone family, member C; H2B histone family, member D; H2B histone family, member E; H2B histone family, member F; H2B histone family, member J; H2B histone family, member K; H2B histone family, member L; H2B histone family, member M; H2B histone family, member N; H2B histone family, member Q; H2B histone family, member R; H2B histone family, member S; H2B histone family, member T; H2B histone family, member U, (testis-specific); H2B histone family, member W, testis-specific; H2B K; H2B type 12; H2B.1; H2B.1A; H2B.1B; H2B.2; H2B/a; H2B/b; H2B/c; H2B/d; H2B/e; H2B/f; H2B/g; H2B/h; H2B/I; H2B/j; H2B/k; H2B/l; H2B/n; H2B/q; H2B/r; H2B/S; H2b-143; h2B-221; H2b-291b; H2b-613; H2Bb; H2BC10; H2bc4; H2BC6; H2BC7; H2BC8; H2b-f; H2BFA; H2BFAiii; H2BFB; H2BFC; H2BFD; H2BFE; H2BFF; H2BFG; H2BFH; H2BFJ; H2BFK; H2BFL; H2BFM; H2BFN; H2BFQ; H2BFR; H2bfs; H2BFT; H2BFU; H2BFWT; H2BGL105; H2BJ; H2b-j; H2BK; H2BK12ac; H2BK15ac; H2BK5ac; H2b-l; H2BLys5ac; H2b-n; H2BQ; H2BS14; H2BS14p; HIRA-interacting protein 1; HIRA-interacting protein 2; HIRIP1; HIRIP2; Hist1h2ba; Hist1h2bb; HIST1H2BC; HIST1H2BD; Hist1h2be; Hist1h2bf; Hist1h2bg; HIST1H2BH; HIST1H2BI; HIST1H2BJ; HIST1H2BK; Hist1h2bl; Hist1h2bm; Hist1h2bn; HIST1H2BO; HIST1H3I; Hist2h2be; HIST2H2BF; Hist3h2bb; histone 1, H2ba; histone 1, H2bb; histone 1, H2bc; histone 1, H2bd; histone 1, H2bg; histone 1, H2bh; histone 1, H2bi; histone 1, H2bj; histone 1, H2bk; histone 1, H2bl; histone 1, H2bm; histone 1, H2bn; histone 1, H2bo; histone 2, H2be; Histone 2B; histone 3, H2bb; histone cluster 1, H2ba; histone cluster 1, H2bb; histone cluster 1, H2bc; histone cluster 1, H2bd; histone cluster 1, H2bg; histone cluster 1, H2bh; histone cluster 1, H2bi; histone cluster 1, H2bj; histone cluster 1, H2bk; histone cluster 1, H2bl; histone cluster 1, H2bm; histone cluster 1, H2bn; histone cluster 1, H2bo; histone cluster 2, H2be; histone cluster 2, H2bf; histone cluster 3, H2bb; histone family member; histone H2B; histone H2B type 1-A; Histone H2B type 1-B; histone H2B type 1-C/E/F/G/I; Histone H2B type 1-C/E/G; histone H2B type 1-D; Histone H2B type 1-F/J/L; histone H2B type 1-H; Histone H2B type 1-J; histone H2B type 1-K; Histone H2B type 1-L; histone H2B type 1-M; Histone H2B type 1-N; histone H2B type 1-O; Histone H2B type 2-E; histone H2B type 2-F; Histone H2B type 3-B; histone H2B type F-M; Histone H2B type F-S; histone H2B type F-S-like; histone H2B type W-T; Histone H2B, testis; Histone H2B.1; histone H2B.1 A; Histone H2B.1 B; histone H2B.2; Histone H2B.a; histone H2B.b; Histone H2B.c; histone H2B.d; Histone H2B.e; histone H2B.f; Histone H2B.g; Histone H2B.h; Histone H2B.I; Histone H2B.j; histone H2B.k; Histone H2B.l; histone H2B.n; Histone H2B.q; histone H2B.r; Histone H2B.s; histone H2B-GL105; LOC102724334; MGC125414; MGC125415; MGC125416; MGC9388; R74621; RP1-193B12.10; STBP; T25626; testis-specific histone 2b; testis-specific histone H2B; Th2b; TSH2B; TSH2B.1
Gene	H2BW2
Product Type	Antibody
Gene ID (Entrez)	102724334, 114483833, 128312, 158983, 255626, 286436, 3017, 3018, 440689, 8339, 8340, 8341, 8342, 8345, 8346, 8347, 8348, 8349, 85236, 8970
Formulation	PBS with 0.09% sodium azide; pH 7.2
Immunogen	Acetylated peptide (Lys5) corresponding to Human H2 (aa 2-9).
Classification	Recombinant Superclonal
Primary or Secondary	Primary
Clone	24HCLC

491

Invitrogen™ BACE2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q9JL18, Q9Y5Z0
Isotype	IgG
Concentration	1 mg/mL
Antigen	BACE2
Gene Symbols	BACE2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1110059C24Rik; 56 kDa aspartic-like protease; AEPLC; AI850424; ALP56; ARP1; asp 1; ASP1; ASP21; Aspartic-like protease 56 kDa; Aspartyl protease 1; Bace2; BAE2; be; beta secretase 2; Beta-secretase 2; beta-site amyloid beta A4 precursor protein-cleaving enzyme 2; beta-site amyloid precursor protein cleaving enzyme 2; Beta-site APP cleaving enzyme 2; beta-site APP-cleaving enzyme 2; CDA13; CEAP1; Down region aspartic protease; Down syndrome region aspartic protease; DRAP; memapsin 1; memapsin-1; Membrane-associated aspartic protease 1; theta-secretase; transmembrane aspartic proteinase Asp1; UNQ418/PRO852
Gene	BACE2
Product Type	Antibody
Gene ID (Entrez)	25825, 56175
Formulation	PBS with 1 mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic Peptide: C P(503) E V V N D E S S L V R H R W K(518).
Classification	Polyclonal
Primary or Secondary	Primary

492

Invitrogen™ CD8a Recombinant Rat Monoclonal Antibody (4SM16), Alexa Fluor™ Plus 488

Rat Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse
Host Species	Rat
Conjugate	Alexa Fluor Plus 488
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Immunocytochemistry
Form	Liquid
Gene Accession No.	P01731, P01732, P10300, P10966
Isotype	IgG2a κ
Concentration	1.0 mg/mL
Antigen	CD8a
Gene Symbols	Cd8a, CD8B, Cd8b1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	BB154331; CD8; CD8 alpha; CD8 alpha chain; CD8 alpha chain precursor; CD8 antigen; CD8 antigen 32 kDa chain; CD8 antigen 37 kDa chain; CD8 antigen alpha polypeptide; CD8 antigen alpha protein; CD8 antigen alpha protein precursor; CD8 antigen alpha-chain; CD8 antigen beta polypeptide; CD8 antigen beta polypeptide precursor; CD8 antigen beta-chain; CD8 antigen, alpha chain; CD8 antigen, alpha polypeptide; CD8 antigen, alpha polypeptide (p32); CD8 antigen, alpha-chain; CD8 antigen, beta chain; CD8 antigen, beta chain 1; CD8 antigen, beta polypeptide; CD8 antigen, beta polypeptide 1 (p37); CD8 antigen, beta-chain; CD8 beta; CD8 beta chain; CD8 beta-2; CD8a; CD8A antigen alpha; CD8a molecule; CD8A; T-cell surface glycoprotein; CD8alpha; CD8B; CD8b antigen; CD8b molecule; CD8b molecule pseudogene; Cd8b1; CD8beta; CD8BP; fCD8; LEU2; Leu-2; Leu2 T-lymphocyte antigen; leu-2a; Ly-2; LY3; Ly-3; Ly-35; Ly-B; Ly-C; Lymphocyte antigen 3; Lyt2; Lyt-2; Lyt-2.1 lymphocyte differentiation antigen (AA at 100); Lyt3; Lyt-3; MAL; membrane glycoprotein; membrane protein; OKT8 T-cell antigen; OX-8 membrane antigen; p32; P37; RHACD8-4; T cell co-receptor; T lymphocyte surface glycoprotein beta chain; T8 T-cell antigen; T-cell antigen Leu2; T-cell membrane glycoprotein Ly-3; T-cell surface glycoprotein; T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 beta chain; T-cell surface glycoprotein Lyt-2; T-cell surface glycoprotein Lyt-3; T-cell surface molecule; T-lymphocyte differentiation antigen T8/Leu-2; type I transmembrane glycoprotein
Gene	CD8B
Product Type	Antibody
Gene ID (Entrez)	12525, 12526, 925, 926
Formulation	Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.8
Immunogen	Fragment of extracellular domain.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	4SM16

493

Invitrogen™ SPRYD4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q8WW59
Isotype	IgG
Concentration	0.05 mg/mL
Antigen	SPRYD4
Gene Symbols	SPRYD4
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	4633402N23Rik; AA114801; RGD1306649; SPRY domain containing 4; SPRY domain-containing protein 4; Spryd4
Gene	SPRYD4
Product Type	Antibody
Gene ID (Entrez)	283377
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein corresponding to Human SPRYD4. Recombinant protein control fragment (Product #RP-97853).
Classification	Polyclonal
Primary or Secondary	Primary

494

Invitrogen™ CD90.1 (Thy-1.1) Monoclonal Antibody (HIS51), Brilliant Ultra Violet™ 395, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse,Rat
Host Species	Mouse
Conjugate	Brilliant Ultraviolet 395
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P01830, P01831
Isotype	IgG2a κ
Concentration	0.2 mg/mL
Antigen	CD90.1 (Thy-1.1)
Gene Symbols	Thy1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD7; CD90; FLJ33325; T25; Thy 1.2; Thy1; Thy-1; Thy-1 antigen; Thy-1 cell surface antigen; thy-1 glycoprotein; thy-1 membrane glycoprotein; Thy-1 protein; Thy1.1; Thy1.2; Thy-1.2; thymus cell antigen 1, theta; Thymus cell surface antigen
Gene	Thy1
Product Type	Antibody
Gene ID (Entrez)	21838, 24832
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HIS51

495

Invitrogen™ CRF Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P01143, P06850, Q8CIT0
Isotype	IgG
Concentration	1 mg/mL
Antigen	CRF
Gene Symbols	CRH
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Corticoliberin; corticotropin releasing factor; corticotropin releasing hormone; corticotropin releasing hormone receptor 2; corticotropin-releasing factor; Corticotropin-releasing factor receptor 2; corticotropin-releasing hormone; Corticotropin-releasing hormone receptor 2; CRF; CRF2; CRF2 receptor, beta isoform; CRF2R; CRFR2; CRF-R-2; CRF-RB; CRH; CRH receptor 2 variant B; CRH1; CRH2R; CRHR2; CRH-R2; CRH-R-2; Gm1347; HM-CRF
Gene	CRH
Product Type	Antibody
Gene ID (Entrez)	12918, 1392, 81648
Formulation	PBS with 50% glycerol and 0.02% sodium azide; pH 7.4
Immunogen	A synthesized peptide derived from human CRH(Accession P06850), corresponding to amino acid residues M1-P50.
Classification	Polyclonal
Primary or Secondary	Primary

Prev
1
...
31
32
33
34
...
110,641
Next

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ Ly-6E Recombinant Rabbit Monoclonal Antibody (HL1933) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CYP27B1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Transferrin Receptor Monoclonal Antibody (MEM-75), PE Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TBP Monoclonal Antibody (3TF1-3G3) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ POLR3F Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ REG1A Monoclonal Antibody (1A4) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Insulin Monoclonal Antibody (C7C9) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ KCNMB1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SHP2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ BACE2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SPRYD4 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CRF Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Ly-6E Recombinant Rabbit Monoclonal Antibody (HL1933)

Invitrogen™ CYP27B1 Polyclonal Antibody

Invitrogen™ Transferrin Receptor Monoclonal Antibody (MEM-75), PE

Invitrogen™ TBP Monoclonal Antibody (3TF1-3G3)

Invitrogen™ POLR3F Polyclonal Antibody

Invitrogen™ REG1A Monoclonal Antibody (1A4)

Invitrogen™ Insulin Monoclonal Antibody (C7C9)

Invitrogen™ KCNMB1 Polyclonal Antibody

Invitrogen™ SHP2 Polyclonal Antibody

Invitrogen™ BACE2 Polyclonal Antibody

Invitrogen™ SPRYD4 Polyclonal Antibody

Invitrogen™ CRF Polyclonal Antibody