Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

5,296 – 5,310 of 1,891,774 results

5,296

Invitrogen™ NFIA Monoclonal Antibody (16H11)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	Q12857
Isotype	IgG2b
Concentration	500 μg/mL
Antigen	NFIA
Gene Symbols	NFIA
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1110047K16Rik; 9430022M17Rik; CCAAT-box-binding transcription factor; CTF; KIAA1439; NF1A; NF1-A; Nf1l21; NF-I/A; Nfia; NFI-A; NFI-L; Nuclear factor 1 A-type; nuclear factor 1/A; nuclear factor I A; nuclear factor I/A; TGGCA-binding protein; Unknown (protein for MGC:128467)
Gene	NFIA
Product Type	Antibody
Gene ID (Entrez)	4774
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	16H11

5,297

Invitrogen™ EGFR Recombinant Rabbit Monoclonal Antibody (30H45L48), Alexa Fluor™ 488

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Rabbit
Conjugate	Alexa Fluor 488
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	P00533
Isotype	IgG
Concentration	1 mg/mL
Antigen	EGFR
Gene Symbols	EGFR
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	2.7.10.1; 9030024J15Rik; AI552599; avian erythroblastic leukemia viral (v-erbB) oncogene homolog; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; EC 2.7.10.1; egf receptor; Egfr; EGFR-related peptide; epidermal growth factor receptor; epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian); Epidermal growth factor receptor formerly avian erythroblastic leukemia viral (v-erbB) oncogene homolog (Erbb1); epidermal growth factor receptor, formerly avian erythroblastic leukemia viral (v-erbB) oncogene homolog (Erbb1); ERBB; ERBB1; ErbB-1; erb-b2 receptor tyrosine kinase 1; Errb1; Errp; HER1; kinase EGFR; mENA; NISBD2; Oncogene ERBB; PIG61; Proto-oncogene c-ErbB-1; receptor tyrosine-protein kinase erbB-1; Urogastrone; wa2; wa-2; Wa5; waved 2
Gene	EGFR
Product Type	Antibody
Gene ID (Entrez)	1956
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4
Immunogen	Proprietary.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	30H45L48

5,298

Invitrogen™ MAG Monoclonal Antibody (2G11)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P07722, P20916, P20917
Isotype	IgG2a
Concentration	500 μg/mL
Antigen	MAG
Gene Symbols	MAG
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1B236; Brain neuron cytoplasmic protein 3; Gma; MAG; myelin associated glycoprotein; myelin-associated glycoprotein; sialic acid binding Ig-like lectin 4A; sialic acid-binding Ig-like lectin 4a; sialic acid-binding immunoglobulin-like lectin 4A; SIGLEC4A; siglec-4a; S-MAG; S-MAG (C-term.); SPG75
Gene	MAG
Product Type	Antibody
Gene ID (Entrez)	17136, 29409, 4099
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	E.coli-derived human MAG recombinant protein (Position: E34-R605).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2G11

5,299

Invitrogen™ CD303a Monoclonal Antibody (201A), APC, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q8WTT0
Isotype	IgG2a κ
Concentration	5 μL/Test
Antigen	CD303a
Gene Symbols	CLEC4C
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	BDCA2; BDCA-2; Blood dendritic cell antigen 2; blood dendritic cell antigen 2 protein; CD303; CD303 antigen; CLEC4C; CLECSF11; CLECSF7; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 11; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 7; C-type lectin domain family 4 member C; C-type lectin domain family 4, member C; C-type lectin domain family 4, member C, isoform 1; C-type lectin superfamily member 7; dendritic cell lectin b; dendritic lectin; DLEC; HECL; PRO34150; UNQ9361/PRO34150
Gene	CLEC4C
Product Type	Antibody
Gene ID (Entrez)	170482
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	201A

5,300

Invitrogen™ Goat anti-Mouse IgG (H+L) Secondary Antibody, HRP

Goat Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Goat
Conjugate	HRP
Applications	ELISA,Immunohistochemistry,Western Blot
Form	Liquid
Isotype	IgG
Concentration	1.5 mg/mL
Antigen	Mouse IgG (H+L)
Regulatory Status	RUO
Purification Method	Purified
Product Type	Secondary Antibody
Formulation	PBS with 4mg/mL BSA, 40% glycerol and 0.19% Kathon™ CG; pH 7.4
Immunogen	Gamma Immunoglobins Heavy and Light chains.
Classification	Polyclonal
Primary or Secondary	Secondary

5,301

Invitrogen™ Goat anti-Mouse IgM (Heavy chain) Secondary Antibody, HRP

Goat Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Goat
Conjugate	HRP
Applications	ELISA,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form	Liquid
Isotype	IgG
Concentration	1 mg/mL
Antigen	Mouse IgM (Heavy chain)
Regulatory Status	RUO
Purification Method	Affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with 4mg/mL BSA, 40% glycerol and 0.19% Kathon™ CG; pH 7.4
Immunogen	Mouse IgM.
Classification	Polyclonal
Primary or Secondary	Secondary

5,302

CD69 Monoclonal Antibody (H1.2F3), Super Bright™ 436, eBioscience™, Invitrogen™

Armenian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Armenian Hamster
Conjugate	Super Bright 436
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG
Gene Accession No.	P37217
Concentration	0.2 mg/mL
Antigen	CD69
Regulatory Status	RUO
Purification Method	Affinity chromatography
Product Type	Antibody
Gene ID (Entrez)	12515
Classification	Monoclonal
Primary or Secondary	Primary
Clone	H1.2F3

5,303

CD19 Monoclonal Antibody (HIB19), Super Bright™ 436, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Super Bright 436
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P15391
Concentration	5 μL/Test
Antigen	CD19
Gene Symbols	Cd19
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AW495831; B4; B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; Cd19; CD19 antigen; CD19 molecule; CVID3; differentiation antigen CD19; Leu-12; T-cell surface antigen Leu-12
Gene	Cd19
Product Type	Antibody
Gene ID (Entrez)	930
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HIB19

5,304

Invitrogen™ CD123 Monoclonal Antibody (6H6), Super Bright™ 436, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Super Bright 436
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P26951
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD123
Gene Symbols	IL3RA
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD123; CD123 antigen; CDw123; Cyrl; cytokine receptor-like protein CYRL; hIL-3Ra; Il-3 alpha subunit; IL-3 receptor alpha chain; IL-3 receptor alpha SP2 isoform; IL-3 receptor subunit alpha; IL3R; IL-3R subunit alpha; Il3ra; IL-3RA; IL-3R-alpha; IL3RAY; IL3RX; IL3RY; interleukin 3 receptor subunit alpha; interleukin 3 receptor, alpha; interleukin 3 receptor, alpha (low affinity); interleukin 3 receptor, alpha chain; interleukin-3 receptor class II alpha chain; Interleukin-3 receptor subunit alpha; Sut-1
Gene	IL3RA
Product Type	Antibody
Gene ID (Entrez)	3563
Formulation	PBS with BSA and 0.09% sodium azide
Classification	Monoclonal
Primary or Secondary	Primary
Clone	6H6

5,305

Invitrogen™ Podoplanin Monoclonal Antibody (eBio8.1.1(8.1.1)), Super Bright™ 436, eBioscience™

Syrian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Syrian Hamster
Conjugate	Super Bright 436
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q62011
Isotype	IgG
Concentration	0.2 mg/mL
Antigen	Podoplanin
Gene Symbols	PDPN
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	29kDa cytosolic podoplanin intracellular domain; Aggrus; CTA-520D8.1; E11; E11 antigen epitope; epithelial cell surface transmembrane protein antigen; glycoprotein 36; Glycoprotein 38; glycoprotein, 36-KD; GP36; Gp38; GP40; HT1A-1; hT1alpha-1; hT1alpha-2; lung type I cell membrane associated glycoprotein; lung type-I cell membrane-associated glycoprotein (T1A-2); Ots8; OTS-8; OTTHUMP00000009640; OTTHUMP00000044504; PA2.26; PA2.26 antigen; PDPN; PICD; Podoplanin; PSEC0003; PSEC0025; pulmonary type I alveolar epithelial cell transmembrane differentiation marker; RANDAM-2; RP23-348F1.2; RTI140; RTI40; T1a; T1A2; T1A-2; T1alpha; T1-alpha; TI1A; Transmembrane glycoprotein E11; type I cell 40 kDa protein
Gene	PDPN
Product Type	Antibody
Gene ID (Entrez)	14726
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBio8.1.1(8.1.1)

5,306

CD4 Monoclonal Antibody (RPA-T4), Super Bright™ 600, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Super Bright 600
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P01730
Concentration	5 μL/Test
Antigen	CD4
Gene Symbols	CD4
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Activation B7-1 antigen; B7; B7.1; B7-1; BB1; B-lymphocyte activation antigen B7; CD28LG; CD28LG1; CD4; CD4 antigen; CD4 antigen (p55); CD4 antigen p55; Cd4 molecule; CD4 precursor; CD4 receptor; CD4, allele 1; cd4a; CD4mut; CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); CD80 molecule; cell surface glycoprotein CD4; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; fCD4; L3T4; LAB7; Leu-3; Ly-4; lymphocyte antigen CD4; lymphocyte antigen CD4 precursor; membrane protein; p55; T-cell differentiation antigen L3T4; T-cell surface antigen T4/Leu-3; T-cell surface glycoprotein CD4; T-cell surface glycoprotein CD4 precursor (T-cell surface antigen T4/Leu-3) (T-cell differentiation antigen L3T4); T-lymphocyte activation antigen CD80; W3/25; W3/25 antigen
Gene	CD4
Product Type	Antibody
Gene ID (Entrez)	920
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RPA-T4

5,307

CD172a (SIRP alpha) Monoclonal Antibody (15-414), Super Bright™ 600, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Super Bright 600
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P78324
Concentration	5 μL/Test
Antigen	CD172a (SIRP alpha)
Gene Symbols	SIRPA
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI835480; Bit; brain Ig-like molecule with tyrosine-based activation motifs; Brain immunoglobulin like protein with tyrosine - based activation motifs; brain immunological-like with tyrosine-based motifs; brain-immunoglobulin-like molecule with tyrosine-based activation motifs; CD172; CD172 alpha; CD172 antigen-like family member A; CD172A; Inhibitory receptor SHPS-1; macrophage fusion receptor; Macrophage membrane protein MFP150; MFR; mSIRP-alpha1; Myd1; MYD-1; myD-1 antigen; p84; Protein tyrosine phosphatase non-receptor type substrate 1 (SHP substrate 1); protein tyrosine phosphatase, non-receptor type substrate 1; Protein tyrosine phosphatase, non-receptor type substrate 1 (SHP substrate 1); Ptpns1; SHP substrate 1; SHP-1; SHPS1; SHPS-1; signal regulatory protein alpha; signal-regulatory protein alpha; signal-regulatory protein alpha-1; Signal-regulatory protein alpha-2; Signal-regulatory protein alpha-3; SIRP; Sirpa; SIRPalpha; Sirp-alpha-1; SIRPalpha2; Sirp-alpha-2; Sirp-alpha-3; swc3; swine workshop cluster 3 antigen; swine workshop cluster 3 antigen precursor; tyrosine phosphatase SHP substrate 1; tyrosine-protein phosphatase non-receptor type substrate 1
Gene	SIRPA
Product Type	Antibody
Gene ID (Entrez)	140885
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	15-414

5,308

Invitrogen™ CD19 Monoclonal Antibody (SJ25C1), Super Bright™ 600, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Super Bright 600
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P15391
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD19
Gene Symbols	Cd19
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AW495831; B4; B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; Cd19; CD19 antigen; CD19 molecule; CVID3; differentiation antigen CD19; Leu-12; T-cell surface antigen Leu-12
Gene	Cd19
Product Type	Antibody
Gene ID (Entrez)	930
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SJ25C1

5,309

Invitrogen™ CD8a Monoclonal Antibody (SK1), Super Bright™ 600, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Super Bright 600
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P01732, P10966
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD8a
Gene Symbols	Cd8a, CD8B
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	BB154331; CD8; CD8 alpha; CD8 alpha chain; CD8 alpha chain precursor; CD8 antigen; CD8 antigen 32 kDa chain; CD8 antigen 37 kDa chain; CD8 antigen alpha polypeptide; CD8 antigen alpha protein; CD8 antigen alpha protein precursor; CD8 antigen alpha-chain; CD8 antigen beta polypeptide; CD8 antigen beta polypeptide precursor; CD8 antigen beta-chain; CD8 antigen, alpha chain; CD8 antigen, alpha polypeptide; CD8 antigen, alpha polypeptide (p32); CD8 antigen, alpha-chain; CD8 antigen, beta chain; CD8 antigen, beta chain 1; CD8 antigen, beta polypeptide; CD8 antigen, beta polypeptide 1 (p37); CD8 antigen, beta-chain; CD8 beta; CD8 beta chain; CD8 beta-2; CD8a; CD8A antigen alpha; CD8a molecule; CD8A; T-cell surface glycoprotein; CD8alpha; CD8B; CD8b antigen; CD8b molecule; CD8b molecule pseudogene; Cd8b1; CD8beta; CD8BP; fCD8; LEU2; Leu-2; Leu2 T-lymphocyte antigen; leu-2a; Ly-2; LY3; Ly-3; Ly-35; Ly-B; Ly-C; Lymphocyte antigen 3; Lyt2; Lyt-2; Lyt-2.1 lymphocyte differentiation antigen (AA at 100); Lyt3; Lyt-3; MAL; membrane glycoprotein; membrane protein; OKT8 T-cell antigen; OX-8 membrane antigen; p32; P37; RHACD8-4; T cell co-receptor; T lymphocyte surface glycoprotein beta chain; T8 T-cell antigen; T-cell antigen Leu2; T-cell membrane glycoprotein Ly-3; T-cell surface glycoprotein; T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 beta chain; T-cell surface glycoprotein Lyt-2; T-cell surface glycoprotein Lyt-3; T-cell surface molecule; T-lymphocyte differentiation antigen T8/Leu-2; type I transmembrane glycoprotein
Gene	Cd8a
Product Type	Antibody
Gene ID (Entrez)	925, 926
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SK1

5,310

CD105 (Endoglin) Monoclonal Antibody (SN6), Super Bright™ 600, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Super Bright 600
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P17813
Concentration	5 μL/Test
Antigen	CD105 (Endoglin)
Gene Symbols	ENG
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI528660; AI662476; CD105; CD105 antigen; cell surface MJ7/18 antigen; Edg; END; Endo; Endoglin; endoglin (Osler-Rendu-Weber syndrome 1); Eng; HHT1; ORW; ORW1; S-endoglin; transmembrane glycoprotein
Gene	ENG
Product Type	Antibody
Gene ID (Entrez)	2022
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SN6

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ NFIA Monoclonal Antibody (16H11) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ EGFR Recombinant Rabbit Monoclonal Antibody (30H45L48), Alexa Fluor™ 488 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MAG Monoclonal Antibody (2G11) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD303a Monoclonal Antibody (201A), APC, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD69 Monoclonal Antibody (H1.2F3), Super Bright™ 436, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD123 Monoclonal Antibody (6H6), Super Bright™ 436, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Podoplanin Monoclonal Antibody (eBio8.1.1(8.1.1)), Super Bright™ 436, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD172a (SIRP alpha) Monoclonal Antibody (15-414), Super Bright™ 600, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD19 Monoclonal Antibody (SJ25C1), Super Bright™ 600, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD8a Monoclonal Antibody (SK1), Super Bright™ 600, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NFIA Monoclonal Antibody (16H11)

Invitrogen™ EGFR Recombinant Rabbit Monoclonal Antibody (30H45L48), Alexa Fluor™ 488

Invitrogen™ MAG Monoclonal Antibody (2G11)

Invitrogen™ CD303a Monoclonal Antibody (201A), APC, eBioscience™

CD69 Monoclonal Antibody (H1.2F3), Super Bright™ 436, eBioscience™, Invitrogen™

Invitrogen™ CD123 Monoclonal Antibody (6H6), Super Bright™ 436, eBioscience™

Invitrogen™ Podoplanin Monoclonal Antibody (eBio8.1.1(8.1.1)), Super Bright™ 436, eBioscience™

CD172a (SIRP alpha) Monoclonal Antibody (15-414), Super Bright™ 600, eBioscience™, Invitrogen™

Invitrogen™ CD19 Monoclonal Antibody (SJ25C1), Super Bright™ 600, eBioscience™

Invitrogen™ CD8a Monoclonal Antibody (SK1), Super Bright™ 600, eBioscience™