Invitrogen™ NFIA Monoclonal Antibody (16H11)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA549256

Catalog No. PIMA549256

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is different from the related mouse sequence by one amino acid, and identical to the related rat sequence. Positive Control - WB: human Hela whole cell, human HEK293 whole cell. IHC: human intestinal cancer tissue, human intestinal cancer tissue, human tonsil tissue. ICC/IF: A431 cell. Flow: U20S cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

NF-1, also designated CTF, consists of a family of CCAAT box binding proteins that stimulate DNA replication and activate transcription. Analysis of human NF-1 messenger RNA has revealed two forms of the NF-1 protein arising from an alternate splicing of a single NF-1 gene. NF-1 binds its consensus DNA element as a homodimer via an amino-terminal DNA binding domain, and activates transcription through a putatively novel, proline-rich, carboxy terminal transactivation domain. The NF-1 protein has been shown to recognize and bind the adenovirus type 2 promoter and activate transcription of herpes simplex virus thymidine kinase genes. The NF-1 consensus element has been found in the upstream promoter region of myriad eukaryotic genes, including that of Ha-Ras, alpha-globin, HSP 70, GRP 78, Histone H1, myelin basic protein and in the Xenopus laevis vitellogenin gene promoter.

Specifications

• Antigen: NFIA
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: Q12857
• Gene Symbols: NFIA
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Clone: 16H11
• Conjugate: Unconjugated
• Gene: NFIA
• Gene Alias: 1110047K16Rik; 9430022M17Rik; CCAAT-box-binding transcription factor; CTF; KIAA1439; NF1A; NF1-A; Nf1l21; NF-I/A; Nfia; NFI-A; NFI-L; Nuclear factor 1 A-type; nuclear factor 1/A; nuclear factor I A; nuclear factor I/A; TGGCA-binding protein; Unknown (protein for MGC:128467)
• Host Species: Mouse
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 4774
• Content And Storage: -20°C
• Form: Lyophilized