Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

1,771 – 1,785 of 1,806,628 results

1,771

Invitrogen™ SLC50A1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	Q9BRV3
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	SLC50A1
Gene Symbols	SLC50A1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	HsSWEET1; LOW QUALITY PROTEIN: sugar transporter SWEET1; MmSWEET1; probable sugar transporter RAG1AP1; RAG1-activating protein 1; RAG1AP1; recombination activating gene 1 activating protein 1; recombination activating gene 1 gene activation; Rga; RGD1308478; RP11-540D14.5; RZPDo834D038D; SCP; SLC50A1; slv; solute carrier family 50 (sugar efflux transporter), member 1; solute carrier family 50 (sugar transporter), member 1; solute carrier family 50 member 1; Stromal cell protein; sugar transporter SWEET1; SWEET1
Gene	SLC50A1
Product Type	Antibody
Gene ID (Entrez)	55974
Formulation	PBS with 2% sucrose and 0.09% sodium azide
Immunogen	synthetic peptide directed towards the middle region of human SLC50A1 (aa 139-188).
Classification	Polyclonal
Primary or Secondary	Primary

1,772

Invitrogen™ PEX2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P28328, P55098
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	PEX2
Gene Symbols	PEX2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography, Protein A
Gene Alias	35 kDa peroxisomal membrane protein; D3Ertd138e; Paf1; PAF-1; PBD5A; PBD5B; peroxin 2; Peroxin-2; peroxisomal biogenesis factor 2; Peroxisomal membrane protein 3; peroxisomal membrane protein 3, 35 kDa; peroxisomal membrane protein 3, 35kDa; peroxisome assembly factor 1; peroxisome assembly factor-1; peroxisome biogenesis factor 2; Pex2; PMP3; Pmp35; Pxmp3; RING finger protein 72; RNF72; Zellweger syndrome homolog; ZWS3
Gene	PEX2
Product Type	Antibody
Gene ID (Entrez)	19302, 5828
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	KLH conjugated synthetic peptide between 165-194 amino acids from the central region of human PXMP3.
Classification	Polyclonal
Primary or Secondary	Primary

1,773

Invitrogen™ FGF21 Monoclonal Antibody (C4)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q9NSA1
Isotype	IgG2b κ
Concentration	1 mg/mL
Antigen	FGF21
Gene Symbols	FGF21
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	FGF; FGF21; FGF-21; FGFL; Fibroblast growth factor; Fibroblast growth factor 21; PRO10196; UNQ3115/PRO10196
Gene	FGF21
Product Type	Antibody
Gene ID (Entrez)	26291
Formulation	PBS with 50% glycerol and 0.05% ProClin 300; pH 7.4
Immunogen	Recombinant Fibroblast Growth Factor 21 (FGF21) (His29-Ser209).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	C4

1,774

Invitrogen™ Visugromab Humanized Recombinant Human Monoclonal Antibody

Human Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Human
Conjugate	Unconjugated
Applications	ELISA
Form	Liquid
Isotype	IgG4 κ
Concentration	1 mg/mL
Antigen	Visugromab Humanized
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	CTL-002
Product Type	Antibody
Formulation	PBS with no preservative
Immunogen	Recombinant Human GDF15.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary

1,775

Invitrogen™ FGF21 Monoclonal Antibody (CL6491)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	Q9NSA1
Isotype	IgG1
Concentration	0.7 mg/mL
Antigen	FGF21
Gene Symbols	FGF21
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	FGF; FGF21; FGF-21; FGFL; Fibroblast growth factor; Fibroblast growth factor 21; PRO10196; UNQ3115/PRO10196
Gene	FGF21
Product Type	Antibody
Gene ID (Entrez)	26291
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Synthetic peptide corresponding to Human FGF21.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	CL6491

1,776

5-HT2C Antibody (JA31-31), Novus Biologicals™

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Conjugate	Unconjugated
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Applications	Immunohistochemistry,Immunohistochemistry (Free Floating),Immunohistochemistry (Paraffin),Western Blot
Form	Purified
Isotype	IgG
Antigen	5-HT2C
Purification Method	Protein A purified
Gene Alias	5-HT1C, 5-HT-1C, 5-HT-2C, 5-HT2C5-hydroxytryptamine receptor 1C, 5-HTR2C, 5-hydroxytryptamine (serotonin) receptor 2C, 5-hydroxytryptamine receptor 2C, HTR1C, serotonin 5-HT-2C receptor, Serotonin receptor 2C
Formulation	TBS (pH7.4), 0.05% BSA, 40% Glycerol with 0.05% Sodium Azide
Gene ID (Entrez)	3358
Classification	Monoclonal
Immunogen	Synthetic peptide within Human 5-HT2C aa 409-458/ 458. (SwissProt: P28335 Human; SwissProt: P34968 Mouse; SwissProt: P08909 Rat)
Primary or Secondary	Primary
Clone	JA31-31

1,777

LRP2 Antibody (545818), PE, R&D Systems™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Antigen	LRP2
Regulatory Status	RUO
Content And Storage	Store at 4°C in the dark.
Target Species	Human
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry,Immunohistochemistry,Immunohistochemistry (Paraffin)
Classification	Monoclonal
Immunogen	Mouse myeloma cell line NS0-derived partial recombinant human Megalin/LRP2 protein (amino acids 3510-3964)
Primary or Secondary	Primary
Clone	545818

1,778

HIF-2 alpha/EPAS1 Antibody - BSA Free, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody has been used in 663 publications

Pricing & Availability
Specifications

Content And Storage	Store at -20 degreesC.
Target Species	Fish,Mouse,Hamster,Human,Mouse,Primate,Ovine,Reptile,Primate,Rabbit,Rat,Reptile,Sheep,Zebrafish
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Blocking Assay,Chemotaxis,ChIP Assay,Co-immunoprecipitation (Co-IP),Dual RNAScope ISH-IHC,ELISA,Flow Cytometry,Gel Supershift,Gel Supershift,Gene Knock-Out,Immunoblot,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,In vitro Assay,In vivo Assay,KnockDown,SDS-Page,Simple Western,Western Blot
Isotype	IgG
Gene Accession No.	Q99814
Research Discipline	Angiogenesis, Apoptosis, Cancer, Cancer Stem Cells, Chromatin Research, Embryonic Stem Cell Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Transcription Factors and Regulators
Concentration	1.0 mg/mL
Antigen	HIF-2 alpha/EPAS1
Gene Symbols	EPAS1
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 1 - 2 ug/mL, Simple Western 1:50, Flow Cytometry, ELISA 1:100 - 1:2000, Immunohistochemistry 1:100, Immunocytochemistry/Immunofluorescence 1:100, Immunoprecipitation 5 ug/ 1 mg lysate, Immunohistochemistry-Paraffin 1:100, Immunohistochemistry-Frozen, Immunoblotting reported in scientific literature (PMID 28115701), In vitro assay reported in scientific literature (PMID 24998849), Gel Super Shift Assays reported in scientific literature (PMID 15184875), SDS-Page, Chromatin Immunoprecipitation (ChIP) 1:10-1:500, Knockout Validated reported in scientific literature (PMID 26861754), KnockDown Validated reported in scientific literature (PMID 31061092), Dual RNAscope ISH-IHC
Molecular Weight of Antigen	96.5 kDa
Gene Alias	anti hif 2 alpha, anti-HIF-2 alpha, Basic-helix-loop-helix-PAS protein MOP2, BHLHE73, Class E basic helix-loop-helix protein 73, ECYT4, endothelial PAS domain protein 1, endothelial PAS domain-containing protein 1, EPAS1, EPAS-1, HIF-1-alpha-like factor,
Product Type	Antibody
Gene ID (Entrez)	2034
Formulation	PBS with 0.05% Sodium Azide
Classification	Polyclonal
Immunogen	This HIF-2 alpha/EPAS1 Antibody was developed against a peptide derived from the C-terminus of mouse/human HIF-2 alpha protein.
Primary or Secondary	Primary
Test Specificity	This HIF-2 alpha/EPAS1 Antibody is specific for HIF-2 alpha/EPAS, and does not cross-react with HIF-1 alpha.

1,779

IgG1 Rat anti-Mouse, Brilliant Violet 711, Clone: A85-1, BD

Rat Monoclonal Antibody

Pricing & Availability

1,780

Invitrogen™ Azurocidin Monoclonal Antibody (5F1)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P20160
Isotype	IgG1
Concentration	1 mg/mL
Antigen	Azurocidin
Gene Symbols	AZU1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AZAMP; AZU; AZU1; Azurocidin; azurocidin 1; CAP37; cationic antimicrobial protein 37; cationic antimicrobial protein CAP37; HBP; Heparin-binding protein; hHBP; HUMAZUR; NAZC; neutrophil azurocidin; pHBP
Gene	AZU1
Product Type	Antibody
Gene ID (Entrez)	566
Formulation	Antibody with no preservative, pH 7.4
Immunogen	Recombinant Human Azurocidin Protein
Classification	Monoclonal
Primary or Secondary	Primary
Clone	5F1

1,781

Invitrogen™ Azurocidin Monoclonal Antibody (6C7)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P20160
Isotype	IgG1
Concentration	1 mg/mL
Antigen	Azurocidin
Gene Symbols	AZU1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AZAMP; AZU; AZU1; Azurocidin; azurocidin 1; CAP37; cationic antimicrobial protein 37; cationic antimicrobial protein CAP37; HBP; Heparin-binding protein; hHBP; HUMAZUR; NAZC; neutrophil azurocidin; pHBP
Gene	AZU1
Product Type	Antibody
Gene ID (Entrez)	566
Formulation	Antibody with no preservative, pH 7.4
Immunogen	Recombinant Human Azurocidin Protein
Classification	Monoclonal
Primary or Secondary	Primary
Clone	6C7

1,782

NLK Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry/Immunofluorescence,Simple Western,Western Blot
Form	Purified
Isotype	IgG
Research Discipline	Protein Kinase, Wnt Signaling Pathway
Antigen	NLK
Regulatory Status	RUO
Purification Method	Immunogen affinity purified
Dilution	Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL
Gene Alias	DKFZp761G1211, EC 2.7.11, EC 2.7.11.24, FLJ21033, LAK1, nemo like kinase, nemo-like kinaseserine/threonine-protein kinase NLK, Protein LAK1
Product Type	Antibody
Gene ID (Entrez)	51701
Formulation	PBS (pH 7.2) and 40% Glycerol
Classification	Polyclonal
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:LRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPS
Primary or Secondary	Primary

1,783

CRISPR-Cas9 Antibody, R&D Systems™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70°C as supplied. 1 month, 2 to 8°C under sterile conditions after reconstitution. 6 months, -20 to -70°C under sterile conditions after reconstitution.
Target Species	Multi-species
Host Species	Mouse
Conjugate	Unconjugated
Applications	Simple Western,Western Blot
Form	Purified
Isotype	IgG2b
Gene Accession No.	Q99ZW2
Antigen	CRISPR-Cas9
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Western Blot 2 μg/mL, Simple Western 20 μg/mL
Gene Alias	Cas9, CRISPR, CRISPR/Cas9, CRISPR-associated endonuclease Cas9/Csn1, CRISPR-associated protein 9 nuclease, CRISPR-Cas9/Csn1, csn1, SPy_1046, SPy1046, SpyCas9
Gene ID (Entrez)	901176
Formulation	Lyophilized from a 0.2 µm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 µm filtered solution in PBS.
Immunogen	E. coli-derived Cas9, Asp2-Asp1368, Accession # Q99ZW2
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects Cas9 in direct ELISAs and Western blots.
Clone	1013816

1,784

C5b-9 Antibody (aE11) - BSA Free, R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody has been used in 4 publications

Pricing & Availability
Specifications

Content And Storage	Store at 4C in the dark.
Target Species	Baboon,Bacteria,Equine,Human,Pig
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunocytochemistry/Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot (Negative),Western Blot
Form	Purified
Isotype	IgG2a κ
Concentration	1.0 mg/mL
Antigen	C5b-9
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Flow Cytometry, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500, Western Blot (Negative)
Gene Alias	MAC, Membrane attack complex, sC5-b9, sC5b-9, TCC, Terminal complement complex
Product Type	Antibody
Classification	Monoclonal
Immunogen	Purified C5b-9
Primary or Secondary	Primary
Test Specificity	Binds both membrane-bound MAC (active) and fluid-phase SC5b-9 complexes (inactive).
Clone	aE11

1,785

RR688 Rat Anti-Mouse ENPP1, BD OptiBuild™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze. The monoclonal antibody was purified from tissue culture supernatant or ascites by affinity chromatography. The antibody was conjugated to the dye under optimum conditions that minimize unconjugated dye and antibody.
Target Species	Mouse
Host Species	Rat
Conjugate	RR688
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Concentration	0.2 mg/mL
Antigen	ENPP1
Regulatory Status	RUO
Gene Alias	4833416E15Rik, CD203c, E-NPP 1, E-NPP1, Ly-41, M6S1, NPP1
Product Type	Antibody
Gene ID (Entrez)	18605
Formulation	Aqueous buffered solution containing ≤0.09% sodium azide.
Classification	Monoclonal
Immunogen	Mouse EL4 T Cell Lymphoma Cell Line
Primary or Secondary	Primary

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ SLC50A1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PEX2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ FGF21 Monoclonal Antibody (CL6491) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Azurocidin Monoclonal Antibody (5F1) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Azurocidin Monoclonal Antibody (6C7) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CRISPR-Cas9 Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SLC50A1 Polyclonal Antibody

Invitrogen™ PEX2 Polyclonal Antibody

Invitrogen™ FGF21 Monoclonal Antibody (CL6491)

Invitrogen™ Azurocidin Monoclonal Antibody (5F1)

Invitrogen™ Azurocidin Monoclonal Antibody (6C7)

CRISPR-Cas9 Antibody, R&D Systems™