Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

1,051 – 1,065 of 1,558,848 results

1,051

Invitrogen™ MBNL1 Monoclonal Antibody (1H1)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q9NR56
Isotype	IgG1
Concentration	1 mg/mL
Antigen	MBNL1
Gene Symbols	MBNL1
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	DKFZp686P06174; EXP; EXP35; EXP40; EXP42; KIAA0428; MBNL; MBNL1; mKIAA0428; muscleblind like splicing regulator 1; muscleblind-like 1; muscleblind-like 1 (Drosophila); muscleblind-like protein 1; muscleblind-like splicing regulator 1; triplet-expansion RNA-binding protein
Gene	MBNL1
Product Type	Antibody
Gene ID (Entrez)	4154
Formulation	PBS with 50% glycerol and 5mM sodium azide
Immunogen	Full-length recombinant human muscleblind-like 1 protein expressed in and purified from E. coli.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	1H1

1,052

Invitrogen™ PSMB9 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P28065, P28076
Isotype	IgG
Concentration	1 mg/mL
Antigen	PSMB9
Gene Symbols	Psmb9
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	beta1i; large multifunctional peptidase 2; large multifunctional protease 2; LMP2; Lmp-2; LMP-2d; low molecular mass polypeptide 2; low molecular mass protein 2; Macropain chain 7; MGC70470; multicatalytic endopeptidase complex chain 7; proteasome (prosome, macropain) subunit, beta type 9 (large multifunctional peptidase 2); proteasome (prosome, macropain) subunit, beta type, 9; proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2); proteasome 20S subunit beta 9; proteasome beta 9 subunit; proteasome catalytic subunit 1i; proteasome chain 7; proteasome subunit beta 6i; proteasome subunit beta 9; proteasome subunit beta type 9; proteasome subunit beta type-9; Proteasome subunit beta-1i; proteasome-related gene 2; proteosome (prosome, macropain) subunit, beta type 9; proteosome (prosome, macropain) subunit, beta type 9 (large multifunctional peptidase 2); proteosome beta 9 subunit; PSMB6i; PSMB9; Really interesting new gene 12 protein; Ring12; RING12 protein
Gene	Psmb9
Product Type	Antibody
Gene ID (Entrez)	16912, 5698
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Mixture of synthetic peptides corresponding to residues C R(207) V I L G N/D E L P K F Y D E(220) of human and mouse proteasome 20S LMP2.
Classification	Polyclonal
Primary or Secondary	Primary

1,053

Invitrogen™ Angiopoietin 1 Polyclonal Antibody

Goat Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Goat
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q15389
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Angiopoietin 1
Gene Symbols	Angpt1
Regulatory Status	RUO
Purification Method	Ammonium sulfate precipitation
Gene Alias	1110046O21Rik; 2810039D03Rik; AGP1; Agpt; Agpt1; ANG1; ang-1; ANG3; ANG-3; angioarrestin; angiopoietin 1; angiopoietin 3; angiopoietin like 1; angiopoietin Y1; angiopoietin-1; Angiopoietin-3; angiopoietin-like 1; angiopoietin-like protein 1; Angiopoietin-related protein 1; Angpt1; ANGPT3; Angptl1; AngY; ARP1; dJ595C2.2; dJ595C2.2 (angiopoietin Y1); endothelial growth factor; KIAA0003; PSEC0154; tie2 receptor ligand; UNQ162; UNQ162/PRO188
Gene	Angpt1
Product Type	Antibody
Gene ID (Entrez)	284
Formulation	TBS with 0.5% BSA and 0.02% sodium azide; pH 7.3
Immunogen	Peptide with sequence C-PDFSSQKLQH.
Classification	Polyclonal
Primary or Secondary	Primary

1,054

Invitrogen™ ASB7 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q9H672
Isotype	IgG
Concentration	0.1 mg/mL
Antigen	ASB7
Gene Symbols	ASB7
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI449039; ankyrin repeat and SOCS box containing 7; ankyrin repeat and SOCS box protein 7; ankyrin repeat and SOCS box-containing 7; ankyrin repeat and SOCS box-containing protein 7; ASB7; Asb-7; D030055C23Rik
Gene	ASB7
Product Type	Antibody
Gene ID (Entrez)	140460
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein corresponding to Human ASB7. Recombinant protein control fragment (Product #RP-102076).
Classification	Polyclonal
Primary or Secondary	Primary

1,055

Invitrogen™ COL11A2 Monoclonal Antibody (GT473)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P13942, Q64739
Isotype	IgG2a
Concentration	1 mg/mL
Antigen	COL11A2
Gene Symbols	COL11A2
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	COL11A2; Collagen alpha-2(XI) chain; collagen type XI alpha 2; collagen type XI alpha 2 chain; collagen XI-like; collagen, type XI, alpha 2; DAQB-79P13.8; DFNA13; DFNB53; FBCG2; HGNC:2187; HKE5; PARP; pro-a2 chain of collagen type XI; procollagen, type XI, alpha 2; putative collagen XI; STL3; type XI collagen alpha2 chain
Gene	COL11A2
Product Type	Antibody
Gene ID (Entrez)	12815, 1302, 294279
Formulation	PBS with no preservative
Immunogen	Recombinant protein encompassing a sequence within the N-terminus region of human COL11A2. The exact sequence is proprietary.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	GT473

1,056

Invitrogen™ Cas9 Monoclonal Antibody (7A9-3A3)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Bacteria
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q99ZW2
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	Cas9
Gene Symbols	cas9
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	cas9; CRISPR9; CRISPR-Cas9; s aureus
Gene	cas9
Product Type	Antibody
Gene ID (Entrez)	901176
Formulation	PBS with 1mg/mL BSA, 30% glycerol and 0.05% sodium azide
Immunogen	Cas9 nuclease.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	7A9-3A3

1,057

Invitrogen™ PCDH15 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	Q96QU1, Q99PJ1
Isotype	IgG
Concentration	500 μg/mL
Antigen	PCDH15
Gene Symbols	PCDH15
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Ames waltzer; av; BB078305; cadherin-related family member 15; CDHR15; DFNB23; DKFZp667A1711; ENSMUSG00000046980; Gm9815; nmf19; Pcdh15; protocadherin 15; protocadherin 15 CD2; protocadherin 15 CD3 isoform; protocadherin related 15; protocadherin-15; protocadherin-15-CD2; protocadherin-related 15; RP11-449J3.2; USH1F
Gene	PCDH15
Product Type	Antibody
Gene ID (Entrez)	11994, 65217, 690865
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence of human PCDH15 (DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ).
Classification	Polyclonal
Primary or Secondary	Primary

1,058

Invitrogen™ nNOS Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat,Rabbit,Bovine
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O19132, P29475, P29476, Q9Z0J4
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	nNOS
Gene Symbols	NOS1
Regulatory Status	RUO
Gene Alias	2310005C01Rik; bNOS; bNOS1; Brain NOS; Constitutive NOS; IHPS1; NC-NOS; neuronal nitric oxide synthase; neuronal nitric oxide synthase NOS1; neuronal NOS; nitric oxidase synthase; nitric oxide synthase; nitric oxide synthase 1; nitric oxide synthase 1 (neuronal); nitric oxide synthase 1, neuronal; nitric oxide synthase, brain; nNOS; N-NOS; nNOS; NOS type I; NO; NOS; NOS Type 1; NOS type I; Nos1; Nos-1; NOS-I; Peptidyl-cysteine S-nitrosylase NOS1; Phospho-bNOS; Phospho-Brain NOS
Gene	NOS1
Product Type	Antibody
Gene ID (Entrez)	100009243, 18125, 24598, 4842, 536132
Formulation	Whole serum with 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues T(724) K R R A I G F K K L A E A V K(739) C of rat bNOS.
Classification	Polyclonal
Primary or Secondary	Primary

1,059

Invitrogen™ AKAP4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	Q5JQC9
Isotype	IgG
Concentration	1 mg/mL
Antigen	AKAP4
Gene Symbols	AKAP4
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	75 kDa fibrous sheath protein; A kinase (PRKA) anchor protein 4; AKAP 82; AKAP4; AKAP-4; akap4 {ECO:0000312; AKAP82; A-kinase anchor protein 4; A-kinase anchor protein 82 kDa; A-kinase anchoring protein 4; cancer/testis antigen 99; CT99; Fsc1; hAKAP82; HI; major sperm fibrous sheath protein; mAKAP82; p82; PRKA4; protein kinase A anchoring protein 4; protein kinase A-anchoring protein 4; RGD:620828}; testis-specific gene HI
Gene	AKAP4
Product Type	Antibody
Gene ID (Entrez)	8852
Formulation	PBS with 0.02% sodium azide
Immunogen	17 amino acid peptide near the amino terminus of human AKAP4.
Classification	Polyclonal
Primary or Secondary	Primary

1,060

Invitrogen™ beta-2 Adaptin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat,Bovine
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P62944, P63010, Q08DS7, Q9DBG3
Isotype	IgG
Concentration	1 mg/mL
Antigen	beta-2 Adaptin
Gene Symbols	AP2B1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1300012O03Rik; adapter-related protein complex 1 subunit beta-1; adapter-related protein complex 2 beta subunit; adapter-related protein complex 2 subunit beta; adaptin, beta 2 (beta); adaptor protein complex AP-1 subunit beta-1; Adaptor protein complex AP-2 subunit beta; adaptor related protein complex 2 beta 1 subunit; adaptor related protein complex 2 subunit beta 1; adaptor related protein complex 2, beta 1 subunit; adaptor-related protein complex 1 subunit beta-1; Adaptor-related protein complex 2 subunit beta; adaptor-related protein complex 2, beta 1 subunit; ADTB2; AI788979; AP-1 complex subunit beta-1; AP105B; AP-2 complex subunit beta; Ap2b1; AP2-BETA; beta adaptin; beta-1-adaptin; beta1-adaptin; Beta-2-adaptin; beta2-adaptin; beta-adaptin; Beta-adaptin 1; CLAPB1; Clathrin assembly protein complex 1 beta large chain; clathrin assembly protein complex 2 beta large chain; clathrin-associated / assembly / adaptor protein, large, beta 1; clathrin-associated/assembly/adaptor; clathrin-associated/assembly/adaptor protein, large, beta 1; golgi adaptor HA1/AP1 adaptin beta subunit; Plasma membrane adaptor HA2/AP2 adaptin beta subunit; testicular tissue protein Li 22
Gene	AP2B1
Product Type	Antibody
Gene ID (Entrez)	140670, 163, 282183, 71770
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues I(588) H R K H L P I H H G S T D A G D S P(606) of human beta Adaptin 2.
Classification	Polyclonal
Primary or Secondary	Primary

1,061

Invitrogen™ Lamin A/C Polyclonal Antibody

Chicken Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse,Rat
Host Species	Chicken
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry,Western Blot
Form	Liquid
Gene Accession No.	P02545, P48678, P48679
Isotype	IgY
Concentration	Conc. Not Determined
Antigen	Lamin A/C
Gene Symbols	LMNA
Regulatory Status	RUO
Gene Alias	70 kDa lamin; cb948; CDCD1; CDDC; CMD1A; CMT2B1; Dhe; EMD2; FPL; FPLD; FPLD2; HGPS; I79_009616; IDC; lamin; lamin A; lamin A/C; lamin A/C L homeolog; lamin A/C-like 1; Lamin A+C mutant; Lamin AC; lamin a-c; lamin C; lamin C2; lamin-A; Lamin-A/C; LDP1; LFP; LGMD1B; LMN1; lmna; LMNA protein; lmna.L; lmna-A; LMNC; LMNL1; mutant 453W; Mutant lamin A/C; nuclear intermediate filament protein; nuclear lamin A; prelamin-A/C; PRO1; progerin mutant; Renal carcinoma antigen NY-REN-32; RP11-54H19.1; unnamed protein product; wu:fk66d12; XELAEV_18040808mg
Gene	LMNA
Product Type	Antibody
Gene ID (Entrez)	16905, 4000, 60374
Formulation	PBS with 0.02% sodium azide
Immunogen	Full length recombinant human lamin A protein expressed in and purified from E. coli.
Classification	Polyclonal
Primary or Secondary	Primary

1,062

Invitrogen™ MAP2 Monoclonal Antibody (MT-08)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human,Mouse,Pig,Pig
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P11137, P20357
Isotype	IgG1
Concentration	1 mg/mL
Antigen	MAP2
Gene Symbols	Map2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	a730034c02; AC091465.1; DKFZp686I2148; G1-397-34; MAP 2; Map2; MAP-2; map2.S; map2a; map-2a; map2ab; MAP2B; MAP2C; MAP2R; microtubule associated protein 2; microtubule associated protein 2 S homeolog; microtubule associated protein 2; microtubule-associated protein 2; microtubule associated protein 2C; microtubule-associated protein 2; microtubule-associated protein-2; Mtap2; Mtap-2; OTTHUMP00000163916; OTTHUMP00000208143; repro4; XELAEV_18047318mg; xmap2
Gene	Map2
Product Type	Antibody
Gene ID (Entrez)	100153306, 17756, 4133
Formulation	PBS with 15mM sodium azide; pH 7.4
Immunogen	Microtubule protein (bovine brain) enriched for kinesin.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MT-08

1,063

Invitrogen™ NTSR1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P30989
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	NTSR1
Gene Symbols	NTSR1
Regulatory Status	RUO
Gene Alias	bK445C9.6; FLJ22086; High-affinity levocabastine-insensitive neurotensin receptor; hNtr1; neurotensin receptor 1; neurotensin receptor 1 (high affinity); neurotensin receptor type 1; NT receptor-1; NT1 receptor; NT-1r; NTR; NTR1; NT-R-1; NTR-1; NTRH; NTRR; NTS1; NTS-1; Ntsr; Ntsr1; RNTR1; Spp382; TIP39
Gene	NTSR1
Product Type	Antibody
Gene ID (Entrez)	4923
Formulation	Whole serum with 0.02% sodium azide
Immunogen	Synthetic peptide corresponding to the C-terminal amino acids K(398)ADSVSSNHTLSSNATRETLY(418) of NTSR1.
Classification	Polyclonal
Primary or Secondary	Primary

1,064

Invitrogen™ Phospho-4EBP1 (Thr36, Thr45) Recombinant Mouse Monoclonal Antibody (V3NTY24), Alexa Fluor™ Plus 647

Mouse Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor Plus 647
Applications	Flow Cytometry,Western Blot
Form	Liquid
Gene Accession No.	Q13541
Isotype	IgG2b κ
Concentration	1 mg/mL
Antigen	Phospho-4EBP1 (Thr36, Thr45)
Gene Symbols	EIF4EBP1
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	4EBP1; 4E-BP1; AA959816; BP-1; eIF4E-binding protein 1; EIF4EBP1; eukaryotic translation initiation factor 4E binding protein 1; eukaryotic translation initiation factor 4E-binding protein 1; MGC431; MGC4316; P/OKCL.6; PHAS-1; PHAS-I; Phosphorylated heat- and acid-stable protein regulated by insulin 1
Gene	EIF4EBP1
Product Type	Antibody
Gene ID (Entrez)	1978
Formulation	Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.3-7.3
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	V3NTY24

1,065

Invitrogen™ V5 Tag Recombinant Rabbit Monoclonal Antibody (SY30-01)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Tag
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	1 mg/mL
Antigen	V5 Tag
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	simian virus 5 antibody; SPV5gp2; sv5; V5; v-5; V5 Epitope Tag
Product Type	Antibody
Formulation	TBS with 40% Glycerol, 0.05% BSA and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide immune sequence is CGKPIPNPLLGLDST.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	SY30-01

Prev
1
...
69
70
71
72
...
103,924
Next

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ MBNL1 Monoclonal Antibody (1H1) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PSMB9 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Angiopoietin 1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ASB7 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ COL11A2 Monoclonal Antibody (GT473) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Cas9 Monoclonal Antibody (7A9-3A3) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PCDH15 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ nNOS Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ AKAP4 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ beta-2 Adaptin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Lamin A/C Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MAP2 Monoclonal Antibody (MT-08) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NTSR1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ V5 Tag Recombinant Rabbit Monoclonal Antibody (SY30-01) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MBNL1 Monoclonal Antibody (1H1)

Invitrogen™ PSMB9 Polyclonal Antibody

Invitrogen™ Angiopoietin 1 Polyclonal Antibody

Invitrogen™ ASB7 Polyclonal Antibody

Invitrogen™ COL11A2 Monoclonal Antibody (GT473)

Invitrogen™ Cas9 Monoclonal Antibody (7A9-3A3)

Invitrogen™ PCDH15 Polyclonal Antibody

Invitrogen™ nNOS Polyclonal Antibody

Invitrogen™ AKAP4 Polyclonal Antibody

Invitrogen™ beta-2 Adaptin Polyclonal Antibody

Invitrogen™ Lamin A/C Polyclonal Antibody

Invitrogen™ MAP2 Monoclonal Antibody (MT-08)

Invitrogen™ NTSR1 Polyclonal Antibody

Invitrogen™ V5 Tag Recombinant Rabbit Monoclonal Antibody (SY30-01)