Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

1,111 – 1,125 of 1,558,848 results

1,111

Invitrogen™ CCR10 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P46092, Q9JL21
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	CCR10
Gene Symbols	CCR10
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CC chemokine receptor 10; C-C chemokine receptor type 10; C-C CKR-10; C-C motif chemokine receptor 10; CC-CKR-10; CCR10; CCR-10; chemokine (C-C motif) receptor 10; chemokine C-C receptor 9; Cmkbr9; G protein-coupled receptor 2; Gpr2; G-protein coupled receptor 2; MGC151420; RP23-281C18.3
Gene	CCR10
Product Type	Antibody
Gene ID (Entrez)	12777, 2826
Formulation	PBS with 0.1% BSA, 30% glycerol and 0.09% sodium azide; pH 7.4
Immunogen	Peptides corresponding to Human CCR10 (aa 14-29, 350-362).
Classification	Polyclonal
Primary or Secondary	Primary

1,112

Invitrogen™ TGF beta-1 Monoclonal Antibody (TB21)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Rabbit,Sheep,Mustelid,Mink
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P01137, P04202, P17246, P50414
Isotype	IgG1
Concentration	1 mg/mL
Antigen	TGF beta-1
Gene Symbols	Tgfb1
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	CED; cytokine; DPD1; LAP; Latency-associated peptide; prepro-transforming growth factor beta-1; regulatory protein; TGF b; TGF b 1; TGF beta; tgf beta 1; tgf beta1; TGF beta-1; TGF beta-1 protein; TGF β; TGF β 1; TGF β1; Tgfb; TGFB1; TGF-B1; Tgfb-1; TGFbeta; TGF-beta 1; TGF-beta 1 protein; TGFbeta1; TGF-beta1; TGF-beta-1; TGFβ1; Transforming growth factor; transforming growth factor b1; transforming growth factor beta; transforming growth factor beta 1; transforming growth factor beta-1; Transforming growth factor beta-1 proprotein; transforming growth factor beta-1 proprotein; transforming growth factor beta-1; transforming growth factor β1; transforming growth factor, beta 1; transforming growth factor, beta 1 (Camurati-Engelmann disease); transforming growth factor, beta-1; transforming growth factor-beta 1; transforming growth factor-beta I; transforming growth factor-beta-1; transforming growth factor-beta-1 precursor; unnamed protein product
Gene	Tgfb1
Product Type	Antibody
Gene ID (Entrez)	100008645, 21803, 443417, 59086, 7040
Formulation	PBS with <0.1% sodium azide
Immunogen	Human Transforming Growth Factor Beta 1 from platelets.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	TB21

1,113

Invitrogen™ Uromodulin Polyclonal Antibody

Sheep Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Mouse
Host Species	Sheep
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Western Blot
Form	Lyophilized
Gene Accession No.	Q91X17
Isotype	IgG
Concentration	0.2 mg/mL
Antigen	Uromodulin
Gene Symbols	Umod
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	ADMCKD2; FJHN; HNFJ; HNFJ1; MCKD2; Tamm-Horsfall urinary glycoprotein; THGP; THP; UMOD; Urehd1; urehr4; Urmodulin (Tamm-Horsfall protein); uromodulin; Uromodulin, secreted form; uromucoid; uromucoid uromucoid
Gene	Umod
Product Type	Antibody
Gene ID (Entrez)	22242
Formulation	PBS with 5% trehalose and No Preservative
Immunogen	Mouse myeloma cell line NS0-derived recombinant mouse Uromodulin Ser24-Ala618.
Classification	Polyclonal
Primary or Secondary	Primary

1,114

Invitrogen™ RPE65 Monoclonal Antibody (401.8B11.3D9)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C or -80°C if preferred
Target Species	Bovine,Canine,Chicken,Human,Mouse,Monkey,Pig,Rat,Frog
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O70276, Q16518, Q28175, Q91ZQ5, Q9TVB8, Q9YGX2
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	RPE65
Gene Symbols	RPE65
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	65kDa; A930029L06Rik; all-trans-retinyl-palmitate hydrolase; BCO family, member 3; BCO3; LCA2; Lutein isomerase; membrane receptor p63; meso-zeaxanthin isomerase; modifier of retinal degeneration 1; Mord1; mRPE65; p63; RBP-binding membrane protein; rd12; retinal pigment epithelium 65; retinal pigment epithelium 65-like; retinal pigment epithelium abundant protein RPE65; retinal pigment epithelium specific protein 65; retinal pigment epithelium, 65 kDa; retinal pigment epithelium-specific 65 kDa protein; retinal pigment epithelium-specific 65kD protein; retinal pigment epithelium-specific protein (65kD); retinal pigment epithelium-specific protein 65kDa; retinal pigment epithelium-specific protein RPE65; Retinitis pigmentos; retinitis pigmentosa 20 (autosomal recessive); retinoid isomerohydrolase; retinoid isomerohydrolase RPE65; retinol isomerase; RP20; RPE65; rpe65 gene for retinal pigment epithelium-specific protein; RPE65, retinoid isomerohydrolase; sRPE65; truncated RPE65
Gene	RPE65
Product Type	Antibody
Gene ID (Entrez)	100516743, 19892, 282043, 395700, 403803, 6121, 89826
Formulation	PBS with 0.02% sodium azide
Immunogen	Bovine RPE65 microsomal membrane proteins.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	401.8B11.3D9

1,115

Invitrogen™ H4K8ac Recombinant Rabbit Monoclonal Antibody (8H5L4), ChIP-Verified

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Peptide Array,ChIP Assay,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P62805
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	H4K8ac
Gene Symbols	H4-16, H4C1, H4C11, H4C14, H4C2, H4C5, H4C9
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	acetyl Histone H4; Acetyl-H4 K8; Acetyl-H4 Lys8; Acetyl-Histone H4 K8; Acetyl-Histone H4 Lys8; CELE_T10C6.11; F07B7.11; F07B7.4; F45F2.12; FO108; H4; H4 histone family, member A; H4 histone family, member I; H4 histone family, member J; H4 histone family, member M; H4 histone family, member N; H4 histone, family 2; H4 K8ac; H4/A; H4/B; H4/C; H4/D; H4/E; H4/G; H4/H; H4/I; H4/J; H4/K; H4/M; H4/n; H4/O; H4/p; H4-12; H4-16; H4-53; H4c1; H4c11; H4C12; H4C13; H4C14; H4C15; H4c2; H4c3; H4C4; H4C5; H4c6; H4C8; H4c9; H4f16; H4F2; H4FA; H4FB; H4FC; H4FD; H4FE; H4FG; H4FH; H4FI; H4FJ; H4FK; H4FM; H4FN; H4FO; H4K8; H4Lys8ac; H4M; his-20; his-22; his-4; his-52; his-54; his-8; HIST1H4; HIST1H4A; Hist1h4b; HIST1H4C; Hist1h4d; HIST1H4E; HIST1H4F; HIST1H4H; Hist1h4i; Hist1h4j; HIST1H4K; HIST1H4L; Hist1h4m; Hist2h4; HIST2H4A; HIST2H4B; Hist4h4; histone 1, H4a; histone 1, H4b; histone 1, H4e; histone 1, H4i; histone 2, H4; histone 2, H4a; Histone 4; Histone 4 family, member M; histone 4, H4; histone cluster 1, H4a; histone cluster 1, H4b; histone cluster 1, H4e; histone cluster 1, H4i; histone cluster 2, H4; histone cluster 2, H4a; Histone Cluster 4; histone cluster 4, H4; histone family member; Histone H2B 2; Histone H4; Histone H4 acetyl; Histone H4A; Histone H4K8; Histone H4K8ac; histone IV, family 2; K06C4.12; K06C4.4; T10C6.11; X04652
Gene	H4C1
Product Type	Antibody
Gene ID (Entrez)	121504, 8294, 8359, 8363, 8366, 8367, 8370
Formulation	PBS with 0.09% sodium azide; pH 7.2
Immunogen	Acetylated peptide (Lys8) corresponding to Human H4 (aa 6-13).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	8H5L4

1,116

beta Amyloid Recombinant Superclonal™ Antibody (4HCLC)

beta Amyloid Recombinant Polyclonal Antibody (4HCLC)

Pricing & Availability

1,117

Invitrogen™ SSEA4 Monoclonal Antibody (MC-813-70), DyLight™ 650

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human
Host Species	Mouse
Conjugate	DyLight 650
Applications	Flow Cytometry,Immunocytochemistry
Form	Liquid
Isotype	IgG3
Concentration	1 mg/mL
Antigen	SSEA4
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	SSEA-4; stage-specific embryonic antigen 4
Product Type	Antibody
Formulation	PBS with proprietary stabilizer and 0.02% sodium azide
Immunogen	human embryonal carcinoma cell line 2102Ep.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MC-813-70

1,118

Invitrogen™ AFP Monoclonal Antibody (AFP-11)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Radioimmune Assays (RIA),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P02771
Isotype	IgG1
Concentration	1 mg/mL
Antigen	AFP
Gene Symbols	AFP
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	a fetoglobulin; a fetoprotein; Afp; AFPD; Alpha fetoglobulin; alpha fetoprotein; alpha-1-fetoprotein; Alpha-fetoglobulin; alpha-fetoprotein; alpha-fetoprotein precursor; alpha-foetoprotein; chloride intracellular channel 6; FETA; fetoglobulin; fetoprotein; HPAFP; a fetoglobulin; a fetoprotein
Gene	AFP
Product Type	Antibody
Gene ID (Entrez)	174
Formulation	PBS with 15mM sodium azide; pH 7.4
Immunogen	Purified alpha Fetoprotein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	AFP-11

1,119

Invitrogen™ Cytokeratin Pan Monoclonal Antibody (C-11), Alexa Fluor™ 488

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse,Rat,Mammalia
Host Species	Mouse
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P02533, P02535, P02538, P04104, P04264, P05783, P05784, P05787, P07744, P08727, P08729, P08730, P08779, P11679, P12035, P13645, P13646, P13647, P19001, P19012, P19013, P35908, P50446, Q01546, Q04695, Q10758, Q3TTY5, Q3UV17, Q4FZU2, Q5BJY9, Q61414, Q61781, Q63279, Q6IFU8, Q6IFV1, Q6IFV3, Q6IFV4, Q6IFW6, Q6IFZ6, Q6IG00, Q6IG01, Q6IG02, Q6IG12, Q6IMF3, Q6P6Q2, Q7Z794, Q922U2, Q9DCV7, Q9QWL7, Q9Z2K1
Isotype	IgG1
Concentration	0.1 mg/mL
Antigen	Cytokeratin Pan
Gene Symbols	KRT1, KRT10, KRT13, KRT14, KRT15, KRT16, KRT17, KRT18, KRT19, KRT2, KRT3, KRT4, KRT5, Krt6a, KRT7, KRT76, KRT77, KRT8
Regulatory Status	RUO
Purification Method	Size-exclusion chromatography
Gene Alias	2310016L08Rik; 3300001P10Rik; 39.1; 40-kDa keratin intermediate filament; 47 kDa cytokeratin; 56 kDa cytokeratin; 57kd keratin; 57kDa keratin; 58 kDa cytokeratin; 60-kDa keratin; 63kDa Keratin; 65 kDa cytokeratin; 67 kDa cytokeratin; AA960620; adult keratin; AI324768; AI528832; AI626930; AI663979; AL022697; alpha keratin; AU019895; AW108092; AW146334; basic epidermal type II cytokeratin (carboxy-terminal region, clone pUF164); BB005427; BCIE; BIE; Card2; cell proliferation-inducing gene 46 protein; CK 2e; CK1; CK-1; CK10; CK-10; CK13; CK-13; CK14; CK-14; CK15; CK-15; CK16; CK-16; CK-17; CK18; CK-18; CK19; CK-19; CK-1B; CK-2e; CK3; CK-3; CK4; CK-4; CK5; CK-5; ck55; CK6A; CK-6A; CK6C; CK-6C; CK6D; CK-6D; CK-6E; CK7; CK-7; CK8; CK-8; CYK18; CYK4; CYK8; CYKER; cytokeratin 1; cytokeratin 10; cytokeratin 13; cytokeratin 14; cytokeratin 15; cytokeratin 16; cytokeratin 18; cytokeratin 19; cytokeratin 3; cytokeratin 4; cytokeratin 5; cytokeratin 6A; cytokeratin 6C; cytokeratin 6D; cytokeratin 7; cytokeratin 8; cytokeratin 8 (370 AA); cytokeratin endo A; Cytokeratin endo B; cytokeratin otokeratin; cytokeratin type II; cytokeratin type II, component Ib/c; cytokeratin type II, component III; cytokeratin VIB; cytokeratin VII; cytokeratin-1; Cytokeratin-10; cytokeratin-13; Cytokeratin-14; cytokeratin-15; Cytokeratin-16; cytokeratin-17; Cytokeratin-18; cytokeratin-19; Cytokeratin-1B; Cytokeratin-2e; cytokeratin-3; Cytokeratin-4; cytokeratin-5; Cytokeratin-6A; cytokeratin-6B; cytokeratin-6C; Cytokeratin-6D; cytokeratin-6E; cytokeratin-7; Cytokeratin-8; cytokeratin-A; Cytoskeletal 57 kDa keratin; D130054E02Rik; D15Wsu77e; DDD; DDD1; ear specific cytokeratin; EBS2; ebs3; ebs4; EGK_03684; EGK_03685; EHK; EHK1; Endo B; EndoA; EndoC; epidermal keratin 10; epidermal keratin VII; epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types; epidermolysis bullosa simplex, Dowling-Meara, Koebner; epidermolytic hyperkeratosis 1; epidermolytic hyperkeratosis; keratosis palmaris et plantaris; epithelial keratin 1; epithelial keratin 10; epithelial keratin 2e; Epithelial keratin-1; Epithelial keratin-2e; EPPK; fgk; fin and gill keratin; FNEPPK; focal non-epidermolytic palmoplantar keratoderma; GK-19; Hair alpha protein; HMWCK; Hom s 5; I79_019823; I79_021074; I79_023185; I79_024335; intermediate filament protein; K1; K10; K13; K14; K15; K16; K17; K18; K19; K1B; K1C1; K1CO; K1CP; K1CS; K2C7; K2C8; K2e; K3; K3 keratin; K4; K5; K6A; K6a keratin; K6C; K6D; K7; K77; K8; Ka10; Ka13; Ka14; Ka15; Ka16; Ka17; Ka19; kamp-keratin derived antimicrobial peptide; Kb1; Kb2; Kb4; Kb7; KDAMP; KER1; Ker10; Ker2; KERA; keratin; keratin 1; keratin 1 (epidermolytic hyperkeratosis); keratin 1, type II; keratin 10; keratin 10 (epidermolytic hyperkeratosis); keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris); keratin 10, type I; keratin 10, type I L homeolog; keratin 10, type I S homeolog; keratin 12, gene 2 S homeolog; keratin 13; keratin 13, type I; keratin 13, type I S homeolog; keratin 14; keratin 14 (epidermolysis bullosa simplex, Dowling-Meara, Koebner); keratin 14, type I; keratin 14, type I L homeolog; keratin 15; keratin 15, gene 1 S homeolog; keratin 15, type I; keratin 16; keratin 16 (focal non-epidermolytic palmoplantar keratoderma); keratin 16, type I; keratin 16, type I S homeolog; keratin 17; keratin 17 L homeolog; keratin 17, type I; keratin 17, type I L homeolog; keratin 18; keratin 18, type I; keratin 19; keratin 19 S homeolog; keratin 19 S homeolog; keratin 19; keratin 19, type I; Keratin 1B; keratin 2; keratin 2 (epidermal ichthyosis bullosa of Siemens); keratin 2 epidermis; keratin 2, type II; keratin 24; keratin 2A; keratin 2A (epidermal ichthyosis bullosa of Siemens); keratin 3; keratin 3, type II; keratin 4; keratin 4, type II; keratin 5; keratin 5 (epidermolysis bullosa simplex Dowling-Meara/Kobner/Weber-Cockayne types); keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockayne types)
Gene	KRT19
Product Type	Antibody
Gene ID (Entrez)	110308, 110310, 120093743, 16661, 16663, 16664, 16665, 16666, 16667, 16668, 16669, 16678, 16681, 16682, 16687, 16691, 25626, 287699, 287700, 287701, 287702, 294853, 300242, 300250, 303530, 315323, 360626, 369017, 374454, 3848, 3849, 3850, 3851, 3852, 3853, 3855, 3856, 3858, 3860, 3861, 3866, 3868, 3872, 3875, 3880, 406220, 406226, 406228, 407757, 450225, 51350, 77055
Formulation	PBS with 0.2% BSA and 15mM sodium azide
Immunogen	Keratin-enriched preparation from human epidermoid carcinoma cell line A431.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	C-11

1,120

Invitrogen™ Phospho-DNA-PK (Ser2056) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ChIP Assay,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P78527
Isotype	IgG
Concentration	1.33 mg/mL
Antigen	Phospho-DNA-PK (Ser2056)
Gene Symbols	PRKDC
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI326420; AU019811; DNA-dependent protein kinase catalytic subunit; DNAPDcs; DNAPK; DNA-PK catalytic subunit; DNA-PKcs; DNPK1; DOXNPH; doxorubicin nephropathy; dxnph; hyper-radiosensitivity of murine scid mutation, complementing 1; HYRC; HYRC1; I79_017613; IMD26; p350; p460; Prkdc; protein kinase, DNA activated, catalytic polypeptide; protein kinase, DNA-activated, catalytic polypeptide; scid; severe combined immunodeficiency; slip; Xrcc7
Gene	PRKDC
Product Type	Antibody
Gene ID (Entrez)	5591
Formulation	PBS with 20% glycerol, 1% BSA and 0.025% ProClin 300; pH 7
Immunogen	Carrier-protein conjugated synthetic peptide surrounding phospho Ser2056 of human DNA-PKcs. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

1,121

Invitrogen™ CXCR6 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot
Form	Liquid
Gene Accession No.	O00574
Isotype	IgG
Concentration	1 mg/mL
Antigen	CXCR6
Gene Symbols	CXCR6
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	BB217514; BONZO; C Cmotif chemokine; C X C motif chemokine; CC motif chemokine; CCmotif chemokine; CD186; CD186 antigen; CDw186; chemokine (C-X-C motif) receptor 6; chemokine receptor CXCR6; CXC; C-X-C chemokine receptor type 6; CXC motif chemokine; C-X-C motif chemokine receptor 6; Cxcr6; CXC-R6; CXCR-6; G protein-coupled receptor; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33; OTTHUMP00000209997; OTTHUMP00000209998; STRL33; TYMSTR
Gene	CXCR6
Product Type	Antibody
Gene ID (Entrez)	10663
Formulation	PBS with 0.02% sodium azide
Immunogen	A peptide corresponding to amino acids near the amino terminus of human Bonzo/STRL33.
Classification	Polyclonal
Primary or Secondary	Primary

1,122

Invitrogen™ MMP9 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P14780, P41245
Isotype	IgG
Concentration	0.44 mg/mL
Antigen	MMP9
Gene Symbols	MMP9
Regulatory Status	RUO
Purification Method	Size-exclusion - Dialysis, Ammonium sulfate precipitation
Gene Alias	67 kDa matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; 92kD gelatinase; 92kD type IV collagenase; 92kDa gelatinase; 92kDa type IV collagenase; 92-kDa type IV collagenase; AW743869; B/MMP9; Clg4b; collagenase type IVB; fj05a08; Gel B; gelatinase B; Gelatinase-B; GELB; macrophage gelatinase; MANDP2; matrix metallo protease; matrix metallopeptidase 9; matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); matrix metalloproteinase 9; matrix metalloproteinase 9 (gelatinase B 92-kDa type IV collagenase); matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); matrix metalloproteinase 9 (gelatinase B, 92kDa matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); matrix metalloproteinase 9 (gelatinase B, 92-kDa type IV collagenase); Matrix metalloproteinase9; matrix metalloproteinase-9; MMP; Mmp9; MMP-9; mmp9 protein; MMP-9 protein; MMPs; Preproform of 92-kDa type IV collagenase (MMP-9): N-terminal; pro-MMP-9; type IV collagenase; type V collagenase; wu:fb02g06; wu:fb07b05; wu:fi98c09; wu:fj05a08; ZFMMP-9; zgc:64165
Gene	MMP9
Product Type	Antibody
Gene ID (Entrez)	17395, 4318
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	KLH conjugated synthetic peptide between 644-673 amino acids from the C-terminal region of human MMP9.
Classification	Polyclonal
Primary or Secondary	Primary

1,123

Invitrogen™ SERCA1 ATPase Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	O14983, Q64578, Q8R429
Isotype	IgG
Concentration	500 μg/mL
Antigen	SERCA1 ATPase
Gene Symbols	ATP2A1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	adult Ca2+ ATPase; ATP2A; ATP2A1; ATP2A3; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1; ATPase, Ca++ transporting, cardiac muscle, fast twitch 1; ATPase, Ca++ transporting, ubiquitous; Ca2+ ATPase; calcium pump 1; Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform; endoplasmic reticulum class 1/2 Ca(2+) ATPase; neonatal Ca2+ ATPase; sarcoplasmic/endoplasmic reticulum calcium ATPase 1; SERCA; SERCA ATPase; Serca1; SERCA1a; SR Ca(2+)-ATPase 1
Gene	ATP2A1
Product Type	Antibody
Gene ID (Entrez)	116601, 11937, 487
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA1 ATPase (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN).
Classification	Polyclonal
Primary or Secondary	Primary

1,124

Invitrogen™ VAV1 Monoclonal Antibody (GT557)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P15498, P27870
Isotype	IgG2b
Concentration	1 mg/mL
Antigen	VAV1
Gene Symbols	VAV1
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	oncogene vav; p95; p95vav; Proto-oncogene vav; VAV; vav 1 guanine nucleotide exchange factor; vav 1 oncogene; vav guanine nucleotide exchange factor 1; vav oncogene; vav proto-oncogene; VAV1; vav-T
Gene	VAV1
Product Type	Antibody
Gene ID (Entrez)	22324, 7409
Formulation	PBS with no preservative
Immunogen	Recombinant protein encompassing a sequence within the center region of human VAV1. The exact sequence is proprietary.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	GT557

1,125

Invitrogen™ Glucocorticoid Receptor Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P04150, P06536, P06537
Isotype	IgG
Concentration	1 mg/mL
Antigen	Glucocorticoid Receptor
Gene Symbols	Nr3c1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	cytosolic/nuclear receptor; fb13f09; GCCR; Gcr; GCRST; glucocorticoid nuclear receptor variant 1; glucocorticoid receptor; glucocorticoid receptor 1; glucocorticoid receptor alpha; GR; gr alpha; GR Kit; Grl; Grl1; Grl-1; Nr3c1; Nuclear receptor subfamily 3 group C member 1; nuclear receptor subfamily 3, group C, member 1; nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor); OTTHUMP00000222854; OTTHUMP00000222858; utouto; utut; wu:fb13f09; zgc:113038
Gene	Nr3c1
Product Type	Antibody
Gene ID (Entrez)	14815, 24413, 2908
Formulation	0.1M tris glycine with 10% glycerol and 0.01% thimerosal; pH 7
Immunogen	Recombinant protein encompassing a sequence within the N-terminus region of human Glucocorticoid Receptor. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

Prev
1
...
73
74
75
76
...
103,924
Next

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ CCR10 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TGF beta-1 Monoclonal Antibody (TB21) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Uromodulin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ RPE65 Monoclonal Antibody (401.8B11.3D9) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SSEA4 Monoclonal Antibody (MC-813-70), DyLight™ 650 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ AFP Monoclonal Antibody (AFP-11) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Cytokeratin Pan Monoclonal Antibody (C-11), Alexa Fluor™ 488 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-DNA-PK (Ser2056) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CXCR6 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MMP9 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SERCA1 ATPase Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VAV1 Monoclonal Antibody (GT557) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Glucocorticoid Receptor Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CCR10 Polyclonal Antibody

Invitrogen™ TGF beta-1 Monoclonal Antibody (TB21)

Invitrogen™ Uromodulin Polyclonal Antibody

Invitrogen™ RPE65 Monoclonal Antibody (401.8B11.3D9)

Invitrogen™ SSEA4 Monoclonal Antibody (MC-813-70), DyLight™ 650

Invitrogen™ AFP Monoclonal Antibody (AFP-11)

Invitrogen™ Cytokeratin Pan Monoclonal Antibody (C-11), Alexa Fluor™ 488

Invitrogen™ Phospho-DNA-PK (Ser2056) Polyclonal Antibody

Invitrogen™ CXCR6 Polyclonal Antibody

Invitrogen™ MMP9 Polyclonal Antibody

Invitrogen™ SERCA1 ATPase Polyclonal Antibody

Invitrogen™ VAV1 Monoclonal Antibody (GT557)

Invitrogen™ Glucocorticoid Receptor Polyclonal Antibody