accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,668,890)
Primary Antibody Matched Pairs (7,502)
Protein Interaction Antibody Pairs (1,477)
Protein Phosphorylation Antibody Pairs (61)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (1)
  • (4)
  • (191,784)

brands

  • (1)
  • (1)
  • (30)
  • (2)
  • (2)
  • (976)
  • (67,510)
  • (14,668)
  • (45)
  • (6)
  • (59,913)
  • (1)
  • (109)
  • (271)
  • (1,312)
  • (581)
  • (2)
  • (1)
  • (10)
  • (1)
  • (1)
  • (48)
  • (1)
  • (7)
  • (6)
  • (1)
  • (13)
  • (1)
  • (1)
  • (2)
  • (7)
  • (3)
  • (3)
  • (2)
  • (10,877)
  • (492)
  • (1)
  • (13)
  • (1)
  • (8)
  • (3)
  • (2)
  • (1)
  • (7)
  • (211)
  • (61)
  • (1)
  • (5)
  • (1)
  • (64)
  • (3)
  • (15)
  • (1)
  • (11)
  • (2)
  • (1)
  • (38)
  • (5)
  • (20)
  • (21)
  • (1)
  • (14,223)
  • (2)
  • (3)
  • (31,007)
  • (86)
  • (476)
  • (2)
  • (1)
  • (11,576)
  • (1)
  • (1)
  • (54)
  • (3,121)
  • (6)
  • (479)
  • (105)
  • (23,375)
  • (1)
  • (4,230)
  • (1)
  • (1)
  • (1)
  • (1)
  • (17,311)
  • (1)
  • (73)
  • (18,958)
  • (139)
  • (227)
  • (3)
  • (2)
  • (62)
  • (1)
  • (1)
  • (2)
  • (29)
  • (5)
  • (1)
  • (3)
  • (13)
  • (416)
  • (2)
  • (12,385)
  • (30)
  • (3)
  • (2)
  • (46)
  • (44)
  • (15,973)
  • (1)
  • (1)
  • (3)
  • (8)
  • (7)
  • (2)
  • (20)
  • (2)
  • (2)
  • (55)
  • (1)
  • (2)
  • (12)
  • (20)
  • (1)
  • (35)
  • (1)
  • (46)
  • (2)
  • (1)
  • (25)
  • (58)
  • (471)
  • (59)
  • (10)
  • (4)
  • (34)
  • (13)
  • (11)
  • (1,214)
  • (8)
  • (10)
  • (2)
  • (20)
  • (11)
  • (2)
  • (26)
  • (2)
  • (1)
  • (3)
  • (5)
  • (2)
  • (60)
  • (93)
  • (1)
  • (1)
  • (173)
  • (212)
  • (5)
  • (124)
  • (2)
  • (1)
  • (2)
  • (13)
  • (915)
  • (1)
  • (114)
  • (2,115)
  • (118)
  • (2,514)
  • (13)
  • (1)
  • (1)
  • (980)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (123)
  • (1)
  • (3)
  • (2)
  • (3)
  • (1)
  • (1)
  • (8)
  • (1)
  • (334)
  • (1)
  • (1,858)
  • (3)
  • (1)
  • (1)
  • (2)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (13)
  • (6)
  • (17)
  • (26)
  • (11)
  • (13)
  • (2)
  • (1)
  • (1)
  • (2)
  • (2)
  • (144)
  • (33)
  • (1)
  • (41)
  • (1)
  • (22)
  • (3)
  • (4)
  • (1)
  • (1)
  • (5)
  • (1)
  • (2)
  • (153,837)
  • (21)
  • (54)
  • (2)
  • (1)
  • (3)
  • (117)
  • (1)
  • (1)
  • (15)
  • (1)
  • (123)
  • (1)
  • (2)
  • (4)
  • (208)
  • (1,101)
  • (1)
  • (9)
  • (3)
  • (10)
  • (8)
  • (2)
  • (38)
  • (1)
  • (1)
  • (1)
  • (2)
  • (1)
  • (91)
  • (12,545)
  • (4)
  • (171)
  • (1)
  • (8)
  • (1)
  • (8,402)
  • (1)
  • (2)
  • (16)
  • (4)
  • (137)
  • (22)
  • (125)
  • (1)
  • (3)
  • (10)
  • (7)
  • (7)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (950,304)
  • (1)
  • (13)
  • (1)
  • (2)
  • (30,511)
  • (13)
  • (34)
  • (1)
  • (1)
  • (1,471)
  • (326)
  • (79)
  • (1)
  • (1)
  • (8)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (2)
  • (24)
  • (35,349)
  • (2)
  • (1)
  • (11)
  • (12,319)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (42)
  • (7)
  • (59)
  • (17)
  • (103,591)
  • (1)
  • (6)
  • (17)
  • (3)
  • (1)
  • (31)
  • (527)
  • (1)
  • (12)
  • (2,477)
  • (2)
  • (1)
  • (4)
  • (2)
  • (468)
  • (1)
  • (8)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1,684)
  • (144)
  • (1)
  • (1)
  • (1)
  • (571)
  • (2)
  • (19,359)
  • (1)
  • (4)
  • (1)
  • (1)
  • (1,796)
  • (4)
  • (3)
  • (2)
  • (828)
  • (2)
  • (1)
  • (1)
  • (1)
  • (10)
  • (1)
  • (1)
  • (3)
  • (40)
  • (1)
  • (4)
  • (1)
  • (1)
  • (6)
  • (1)
  • (2)
  • (2,907)
  • (8)
  • (1)
  • (62)
  • (2)
  • (10)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (8)
  • (5)
  • (1)
  • (20)
  • (1)
  • (2)
  • (28)
  • (292)
  • (1)
  • (3)
  • (2)
  • (17)
  • (1)
  • (1)
  • (10)
  • (9)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (40)
  • (7)

special interests

  • (154)
  • (14,978)
  • (166,598)
  • (31)
  • (1,084,976)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (901)
  • (1,756)
  • (4,347)
Show all

Classification

  • (81)
  • (105)
  • (702,578)
  • (3,641)
  • (5)
  • (684,117)
  • (31,171)
Show all

Host Species

  • (565)
  • (2,591)
  • (38)
  • (1)
  • (15)
  • (1,621)
  • (726)
Show all

Conjugate

  • (28,753)
  • (9)
  • (1)
  • (25)
  • (2,809)
  • (74)
  • (89)
Show all

Applications

  • (2)
  • (20)
  • (23)
  • (133)
  • (830)
  • (393)
  • (94)
Show all

Target Species

  • (51)
  • (34)
  • (86)
  • (32)
  • (5)
  • (1,049)
  • (125)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Regulatory Status

  • (335)
  • (960)
  • (1,335,227)

Form

  • (2,698)
  • (2,107)
  • (1,630)
  • (14)
  • (9)
  • (21)
  • (298,034)
Show all

Research Discipline

  • (1)
  • (3)
  • (1)
  • (2)
  • (1)
  • (1)
  • (2)
Show all

Search Within Results
Keyword Search:
1,381 – 1,395 of 1,599,993 results
1,381

Invitrogen™ E-cadherin Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat,Zebrafish
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Free Floating),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Proximity Ligation Assay,Immunocytochemistry
Form Liquid
Gene Accession No. P09803, P12830, Q9R0T4
Isotype IgG
Concentration 0.14 mg/mL
Antigen E-cadherin
Gene Symbols CDH1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias AA960649; ARC-1; cadherin 1; cadherin 1, E-cadherin (epithelial); cadherin 1, epithelial; cadherin 1, type 1; cadherin 1, type 1, E-cadherin (epithelial); cadherin e; cadherin-1; cadherin-E; calcium-dependent adhesion protein, epithelial; CAM 120/80; CD324; CDH1; CDHE; cell adhesion molecule; cell-CAM 120/80; ECAD; E-cad; E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3; Ecadherin; E-cadherin; E-cadherin 1; E-cadherin precursor; Epithelial cadherin; hab; half baked; LCAM; L-CAM; Um; UVO; Uvomorulin
Gene CDH1
Product Type Antibody
Gene ID (Entrez) 114424, 12550, 83502, 999
Formulation PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen Recombinant protein encompassing a sequence within the center region of human E-Cadherin. The exact sequence is proprietary.
Classification Polyclonal
Primary or Secondary Primary
1,382

Invitrogen™ CD69 Monoclonal Antibody (FN50), eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry
Form Liquid
Gene Accession No. Q07108
Isotype IgG1 κ
Concentration 0.5 mg/mL
Antigen CD69
Gene Symbols CD69
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 5830438K24Rik; Activation inducer molecule; activation inducer molecule (AIM/CD69); AI452015; AIM; BL-AC/P26; CD69; CD69 antigen; CD69 antigen (p60, early T-cell activation antigen); CD69 molecule; CLEC2C; C-type lectin domain family 2 member C; C-type lectin domain family 2, member C; EA1; early activation antigen CD69; early lymphocyte activation antigen; early T-cell activation antigen p60; GP32/28; leukocyte surface antigen Leu-23; MLR-3; VEA; Very Early Activation Antigen
Gene CD69
Product Type Antibody
Gene ID (Entrez) 969
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone FN50
1,383

FOXP3 Monoclonal Antibody (PCH101), FITC, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Chimpanzee,Cynomolgus Monkey,Human,Monkey,Rhesus Macaque
Host Species Rat
Conjugate FITC
Applications Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin)
Form Liquid
Isotype IgG2a κ
Gene Accession No. Q6U8D7, Q9BZS1
Concentration 5 μL/Test
Antigen FOXP3
Gene Symbols Foxp3
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias AIID; DIETER; forkhead box P3; forkhead box protein P3; Forkhead box protein P3 41 kDa form; Forkhead box protein P3, C-terminally processed; forkhead/winged helix transcription factor 3; Foxp3; FOXP3delta7; immune dysregulation, polyendocrinopathy, enteropathy, X-linked; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; IPEX; JM2; MGC141961; MGC141963; PIDX; regulatory protein Foxp3; RGD1562112; RP23-54C14.1; scurfin; scurfy; sf; XPID
Gene Foxp3
Product Type Antibody
Gene ID (Entrez) 102120882, 50943, 574303, 740909
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone PCH101
1,384

Invitrogen™ PCSK9 Monoclonal Antibody (2F1)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse
Host Species Mouse
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Western Blot
Form Liquid
Gene Accession No. Q80W65, Q8NBP7
Isotype IgG2b
Concentration 2 mg/mL
Antigen PCSK9
Gene Symbols PCSK9
Regulatory Status RUO
Purification Method Protein A
Gene Alias AI415265; AI747682; convertase subtilisin; convertase subtilisin/kexin type 9 preproprotein; FH3; HCHOLA3; hypercholesterolemia; LDLCQ1; NARC1; NARC-1; neural apoptosis regulated convertase 1; neural apoptosis-regulated convertase 1; OTTHUMP00000009833; PC9; PCSK9; Proprotein convertase 9; proprotein convertase PC9; proprotein convertase subtilisin/kexin type 9; PSEC0052; Subtilisin/kexin-like protease PC9
Gene PCSK9
Product Type Antibody
Gene ID (Entrez) 100102, 255738
Formulation PBS with 50% Glycerol, 0.2% BSA and 0.05% sodium azide; pH 7.4
Immunogen Recombinant protein with Human PCSK9 1-201.
Classification Monoclonal
Primary or Secondary Primary
Clone 2F1
1,385

Invitrogen™ CD328 (Siglec7) Monoclonal Antibody (eBioQA79 (QA79)), PE, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. Q9Y286
Isotype IgG1
Concentration 5 μL/Test
Antigen CD328 (Siglec7)
Gene Symbols SIGLEC7
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Adhesion inhibitory receptor molecule 1; adhesion inhibitory receptor molecule 1, siglec-7; AIRM1; AIRM-1; CD328; CDw328; D-siglec; p75; p75/ AIRM-1; p75/AIRM1; QA79; QA79 membrane protein; sialic acid binding Ig like lectin 7; sialic acid binding Ig-like lectin 7; sialic acid binding immunoglobulin-like lectin 7; sialic acid-binding Ig-like lectin 7; Siglec; SIGLEC19P; SIGLEC7; SIGLEC-7; SIGLECP2
Gene SIGLEC7
Product Type Antibody
Gene ID (Entrez) 27036
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone eBioQA79 (QA79)
1,386

Invitrogen™ CD45R (B220) Monoclonal Antibody (HIS24), APC, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Rat
Host Species Mouse
Conjugate APC
Applications Flow Cytometry
Form Liquid
Gene Accession No. P04157
Isotype IgG2b κ
Concentration 0.2 mg/mL
Antigen CD45R (B220)
Gene Symbols PTPRC
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias B220; Cd45; CD45 antigen; CD45R; GP180; Lca; L-CA; leucocyte common antigen; leukocyte common antigen; leukocyte common antigen A; leukocyte common antigen B; loc; LY5; Ly-5; Lymphocyte antigen 5; lymphocyte common antigen; Lyt-4; membrane tyrosine phosphatase; protein tyrosine phosphatase receptor type C; protein tyrosine phosphatase, receptor type C; protein tyrosine phosphatase, receptor type, C; protein tyrosine phosphatase, receptor type, c polypeptide; Protein tyrosine phosphatase, receptor-type, c polypeptide; Ptprc; Receptor-type tyrosine-protein phosphatase C; RT7; T200; T200 glycoprotein; T200 leukocyte common antigen
Gene PTPRC
Product Type Antibody
Gene ID (Entrez) 24699
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone HIS24
1,387

TCR gamma/delta Monoclonal Antibody (eBioGL3 (GL-3, GL3)), FITC, eBioscience™, Invitrogen™
GREENER_CHOICE

Armenian Hamster Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Armenian Hamster
Conjugate FITC
Applications Flow Cytometry
Form Liquid
Isotype IgG
Gene Accession No. 0
Concentration 0.5 mg/mL
Antigen TCR gamma/delta
Gene Symbols Tcrd, Tcrg
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias RGD1311300; similar to T cell receptor V delta 6; T cell receptor gamma locus; T3/TCR complex; TCR delta gamma; TCR gamma/delta; TCR-CD3 complex; Tcrg; Trg; Trg@
Product Type Antibody
Gene ID (Entrez) 110066, 110067
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone eBioGL3 (GL-3, GL3),GL3)
1,388

Invitrogen™ Apolipoprotein B Monoclonal Antibody (6G6)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications ELISA,Flow Cytometry,Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P04114
Isotype IgG1
Concentration Conc. Not Determined
Antigen Apolipoprotein B
Gene Symbols APOB
Regulatory Status RUO
Gene Alias Aa1064; Ac1-060; AI315052; Apo B100; Apo B-100; Apo B-48; APOB; apo-B; ApoB 100; ApoB 48; ApoB-100; apob-48; apolipo b; apolipoprotein B; apolipoprotein B (including Ag(x) antigen); Apolipoprotein B 100; Apolipoprotein B 48; apolipoprotein B PI; Apolipoprotein B100; apolipoprotein B-100; apolipoprotein B46; apolipoprotein B47; apolipoprotein B48; Apolipoprotein B-48; apolipoprotein B49; FLDB; LDLCQ4; LOX-1; mCG_129875; MGC176318; Ox-LDL receptor 1
Gene APOB
Product Type Antibody
Gene ID (Entrez) 338
Formulation ascites with 0.03% sodium azide
Immunogen Purified recombinant fragment of human ApoB expressed in E. Coli.
Classification Monoclonal
Primary or Secondary Primary
Clone 6G6
1,389

CD80 (B7-1) Monoclonal Antibody (16-10A1), Super Bright™ 645, eBioscience™, Invitrogen™
GREENER_CHOICE

Armenian Hamster Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Canine,Mouse,Pig
Host Species Armenian Hamster
Conjugate Super Bright 645
Applications Flow Cytometry
Form Liquid
Isotype IgG
Gene Accession No. Q00609
Concentration 0.2 mg/mL
Antigen CD80 (B7-1)
Gene Symbols CD80
Regulatory Status RUO
Purification Method Affinity chromatography
Product Type Antibody
Gene ID (Entrez) 12519, 397161, 403765
Classification Monoclonal
Primary or Secondary Primary
Clone 16-10A1
1,390

Invitrogen™ ULBP1 Recombinant Rabbit Monoclonal Antibody (4H27L8)

Rabbit Recombinant Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. Q9BZM6
Isotype IgG
Concentration 0.5 mg/mL
Antigen ULBP1
Gene Symbols ULBP1
Regulatory Status RUO
Purification Method Protein A
Gene Alias A430108B07Rik; ALCAN-beta; MULT1; N2DL1; N2DL-1; NKG2D ligand; NKG2D ligand 1; NKG2D ligand1; NKG2DL1; RAET1I; retinoic acid early transcript 1I; UL16 binding protein 1; UL16-binding protein 1; UL16-binding protein-like transcript 1; ULBP; ULBP 1; ULBP1
Gene ULBP1
Product Type Antibody
Gene ID (Entrez) 80329
Formulation PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen Protein corresponding to human ULBP1 [aa29-aa126].
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone 4H27L8
1,391

Invitrogen™ NTCP Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C
Target Species Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form Lyophilized
Gene Accession No. O08705, P26435
Isotype IgG
Concentration 500 μg/mL
Antigen NTCP
Gene Symbols SLC10A1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias bile acid cotransporting polypeptide; cell growth-inhibiting gene 29 protein; GIG29; growth-inhibiting protein 29; hepatic sodium-dependent bile acid transporter; LOW QUALITY PROTEIN: sodium/bile acid cotransporter; MGC128766 protein; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; Na/taurocholate cotransporting polypeptide; NA-dependent cholate transporting protein; Ntcp; Ntcp1; SBACT; Slc10a1; sodium bile acid cotransporting polypeptide; sodium/bile acid cotransporter; sodium/tauro; sodium/taurocholate cotransporter; sodium/taurocholate cotransporting polypeptide; sodium-dependent bile acid cotransporter; sodium-dependent taurocholate cotransporting polypeptide; sodium-taurocholate cotransporting polypeptide; solute carrier family 10 (sodium/bile acid cotransporter family), member 1; solute carrier family 10 (sodium/bile acid cotransporter), member 1; solute carrier family 10 member 1; solute carrier family 10, member 1
Gene SLC10A1
Product Type Antibody
Gene ID (Entrez) 20493, 24777
Formulation PBS with 4mg trehalose and no preservative
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK).
Classification Polyclonal
Primary or Secondary Primary
1,392

Invitrogen™ Ki-67 Monoclonal Antibody (20Raj1), eFluor™ 570, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Canine,Human
Host Species Mouse
Conjugate eFluor 570
Applications Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunocytochemistry
Form Liquid
Gene Accession No. P46013
Isotype IgG1 κ
Concentration 0.2 mg/mL
Antigen Ki-67
Gene Symbols Mki67
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias antigen identified by monoclonal antibody Ki 67; antigen identified by monoclonal antibody Ki-67; Antigen identified by monoclonal antibody Ki-67 homolog; Antigen KI-67; Antigen KI-67 homolog; antigen KI-67; proliferation marker protein Ki-67; antigen KI-67-like; cb31; D630048A14Rik; I79_022666; Ki67; Ki-67; KIA; LOW QUALITY PROTEIN: proliferation marker protein Ki-67; marker of proliferation Ki-67; MIB-; MIB-1; Mki67; PPP1R105; Proliferation marker protein Ki-67; proliferation-related Ki-67 antigen; protein phosphatase 1, regulatory subunit 105; RP11-380J17.2; sb:cb31; si:ch211-250b22.7; unnamed protein product; wu:fa11g09; wu:fb57a07; wu:fi14e05
Gene Mki67
Product Type Antibody
Gene ID (Entrez) 100686578, 4288
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 20Raj1
1,393

Invitrogen™ BDKRB2 Recombinant Superclonal™ Antibody (13HCLC)

Rabbit Recombinant Superclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Western Blot
Form Liquid
Gene Accession No. P30411
Isotype IgG
Concentration 0.5 mg/mL
Antigen BDKRB2
Gene Symbols BDKRB2
Regulatory Status RUO
Purification Method Protein A
Gene Alias B(2); B2; B2 bradykinin receptor; B2BKR; B2BRA; B2R; BDKRB2; BK2; BK-2; BK-2 receptor; BK2R; BK-2R; BK-2Rs; BKR2; bradykinin receptor B2; bradykinin receptor, beta 2; BRB2; DKFZp686O088; kinin B2
Gene BDKRB2
Product Type Antibody
Gene ID (Entrez) 624
Formulation PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen Peptide corresponding to human BDKRB2 [aa377-aa391].
Classification Recombinant Superclonal
Primary or Secondary Primary
Clone 13HCLC
1,394

FOXP3 Monoclonal Antibody (236A/E7), eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C
Target Species Human,Monkey,Rhesus Macaque
Host Species Mouse
Conjugate Unconjugated
Applications Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Isotype IgG1 κ
Gene Accession No. Q9BZS1
Concentration 0.5 mg/mL
Antigen FOXP3
Gene Symbols Foxp3
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias AIID; DIETER; forkhead box P3; forkhead box protein P3; Forkhead box protein P3 41 kDa form; Forkhead box protein P3, C-terminally processed; forkhead/winged helix transcription factor 3; Foxp3; FOXP3delta7; immune dysregulation, polyendocrinopathy, enteropathy, X-linked; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; IPEX; JM2; MGC141961; MGC141963; PIDX; regulatory protein Foxp3; RGD1562112; RP23-54C14.1; scurfin; scurfy; sf; XPID
Gene Foxp3
Product Type Antibody
Gene ID (Entrez) 50943, 574303
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 236A/E7
1,395

CD40 Monoclonal Antibody (1C10), Brilliant Violet™ 605, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate Brilliant Violet 605
Applications Flow Cytometry
Form Liquid
Isotype IgG2a κ
Gene Accession No. P27512
Concentration 0.2 mg/mL
Antigen CD40
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias AI326936; B cell surface antigen CD40; B cell-associated molecule; B-cell surface antigen CD40; Bp50; CD antigen CD40; Cd40; CD40 antigen; CD40 antigen (TNF receptor superfamily member 5); CD40 antigen, TNF receptor superfamily member 5; CD40 molecule; CD40 molecule, TNF receptor superfamily member 5; CD40L receptor; CDw40; GP39; HIGM1; I79_006806; IGM; IMD3; Immunoglobulin M; ImmunoglobulinM; membrane protein CD40; MGC9013; p50; receptor for ligand CD154; sCD40; soluble CD40; T-BAM; T-cell differentiation antigen; Tnfrsf5; TRAP; tumor necrosis factor receptor superfamily member 5; tumor necrosis factor receptor superfamily, member 5
Gene CD40
Product Type Antibody
Gene ID (Entrez) 21939
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 1C10