Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

1,411 – 1,425 of 1,570,458 results

1,411

Invitrogen™ Phospho-Histone H3 (Ser10) Monoclonal Antibody (K.872.3)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P68431, P68433, P84228, Q71DI3
Isotype	IgG1
Concentration	50 μg/mL
Antigen	Phospho-Histone H3 (Ser10)
Gene Symbols	H3C1, H3C10, H3C12, H3C14, H3C15, H3C2, H3C7, HIST1H3A
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	BUR5; CG31613; CG31613-PA; CG33803; CG33806; CG33809; CG33812; CG33815; CG33818; CG33821; CG33824; CG33827; CG33830; CG33833; CG33836; CG33839; CG33842; CG33845; CG33848; CG33851; CG33854; CG33857; CG33860; CG33863; CG33866; CG5825; CG5825-PA; CG5825-PC; CG5825-PD; CG8989; dH3.3A; Dmel\CG31613; Dmel\CG5825; Dmel_CG31613; Dmel_CG5825; fb58e10; h3; H3 histone; H3 histone family, member A; H3 histone family, member I; H3 histone family, member K; H3 histone family, member L; H3 histone family, member M; H3 histone, family 2; H3 histone, family 3A; H3 histone, family 3B; H3 histone, family 3B (H3.3B); H3 histone, family 3B.1; H3 histone, family 3C; H3.1-221; H3.1-291; H3.1-I; H3.2; H3.2-221; H3.2-614; H3.2-615; H3.2-616; h3.2a; H3.3; H3.3 histone A; H3.3 histone B; H3.3a; H3.3B; H3.5; H3.5 histone; H3.A; H3.B; H3/A; H3/b; H3/d; H3/f; H3/i; H3/j; H3/k; H3/l; H3/M; H3/n; H3/o; H3-143; H3-291; H3-3A; H3-3B; H3-5; H3-53; H3-614; H3a; H3b; H3-B; H3C1; H3c10; H3c11; H3C12; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3f; H3-F; H3F1K; H3F2; H3F3; h3f3a; H3F3A protein; H3f3b; h3f3b.1; H3F3C; h3f3d; H3FA; H3FB; H3FC HIST1H3C; H3FD; H3FF; H3FH; H3FI; H3FJ; H3FK; H3FL; H3FM; H3FN; H3g; H3h; H3i; H3L-like histone; h3r; H3S10ph; H4 clustered histone 16; H4 clustered histone 19; H4C16; H4C19; HHT1; HHT2; His3; His3.3; His3.3A; His-3.3A; His3.3A-PA; His3.3A-PC; His3.3A-PD; His3.3B; His3:CG31613; His3:CG31613-PA; His3:CG33803; His3:CG33806; His3:CG33809; His3:CG33812; His3:CG33815; His3:CG33818; His3:CG33821; His3:CG33824; His3:CG33827; His3:CG33830; His3:CG33833; His3:CG33836; His3:CG33839; His3:CG33842; His3:CG33845; His3:CG33848; His3:CG33851; His3:CG33854; His3:CG33857; His3:CG33860; His3:CG33863; His3:CG33866; Hist1; Hist1h2ai; Hist1h2ail; Hist1h2ail1; HIST1H3A; HIST1H3B; Hist1h3c; HIST1H3D; Hist1h3e; Hist1h3f; Hist1h3g; hist1h3g.L; HIST1H3H; HIST1H3I; HIST1H3J; hist2h3; HIST2H3A; Hist2h3b; HIST2H3C; Hist2h3c1; Hist2h3c2; Hist2h3c2-ps; Hist2h3ca1; Hist2h3ca2; HIST2H3D; histone; histone 1, H2ai; histone 1, H3a; histone 1, H3b; histone 1, H3f; histone 1, H3h; histone 2, H3a; histone 2, H3c; histone 2, H3c2; histone 2, H3ca2; Histone 3; histone cluster 1 H3 family member a; histone cluster 1, H2ai; histone cluster 1, H2ai-like; histone cluster 1, H2ai-like1; histone cluster 1, H3a; histone cluster 1, H3b; histone cluster 1, H3f; histone cluster 1, H3g protein L homeolog; histone cluster 1, H3h; Histone Cluster 2 H3a; histone cluster 2, H3a; histone cluster 2, H3c; histone cluster 2, H3c2; histone cluster 2, H3c2, pseudogene; histone cluster 3, H3; histone gene complex 1; histone H3; Histone H3 containing protein; histone H3.1; Histone H3.2; histone H3.2-like; histone H3.3; Histone H3.3A; Histone H3.3B; Histone H3.3C; histone H3.3C-like; histone H3.3-like protein; Histone H3.5; histone H3/a; Histone H3/b; Histone H3/c; Histone H3/d; Histone H3/f; Histone H3/h; Histone H3/i; Histone H3/j; Histone H3/k; histone H3/l; Histone H3/m; histone H3/o; histone H3-like; histone H4; histone variant H3.5; hypothetical protein LOC406269; hypothetical protein LOC550262; I79_014844; lamprey; lpy; M32461; N2749; PH3; PP781; similar to H3 histone, family 3A; SIN2; Unknown (protein for MGC:128166); wu:fa25h06; wu:fa96g06; wu:fb07a08; wu:fb36f01; wu:fb58e10; XELAEV_18028537mg; YBR010W; YBR0201; YNL031C; zgc:110292; zgc:174300; zgc:56193; zgc:56418; zgc:64222; zgc:86731
Gene	H3C1
Product Type	Antibody
Gene ID (Entrez)	0, 126961, 260423, 291159, 310678, 319150, 319152, 333932, 360198, 679994, 8350, 8356, 8357, 8358, 8968, 97114
Formulation	0.01M HEPES with 100μg/mL BSA, 50% glycerol, 0.15M NaCl and <0.02% sodium azide; pH 7.5
Immunogen	Synthetic phosphopeptide corresponding to residues surrounding pSer10 of human histone H3.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	K.872.3

1,412

Invitrogen™ CD11c Monoclonal Antibody (N418), Brilliant Violet™ 605, eBioscience™

Armenian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Armenian Hamster
Conjugate	Brilliant Violet 605
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q9QXH4
Isotype	IgG
Concentration	0.2 mg/mL
Antigen	CD11c
Gene Symbols	Itgax
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI449405; CD11 antigen-like family member C; CD11c; CD11C (p150) alpha polypeptide; complement component 3 receptor 4 subunit; complement receptor 4; Cr4; integrin alpha X; integrin alpha-X; integrin aX; integrin subunit alpha X; integrin, alpha X; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin, alpha X (complement component 3 receptor 4 subunit); Itgax; Leu M5; leu M5, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150,95; leukocyte surface antigen p150,95, alpha subunit; myeloid membrane antigen, alpha subunit; N418; p150 95 integrin alpha chain; RGD1561123; SLEB6
Gene	Itgax
Product Type	Antibody
Gene ID (Entrez)	16411
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	N418

1,413

Invitrogen™ Cyclin T1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O60563
Isotype	IgG
Concentration	1.0 mg/mL
Antigen	Cyclin T1
Gene Symbols	Ccnt1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	2810478G24Rik; AI115585; CCNT; CCNT1; CDK9-associated C-type protein; cyclin C-related protein; cyclin T1; cyclin T1b; cyclin-T; cyclin-T1; CycT1; HIVE1; human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1
Gene	Ccnt1
Product Type	Antibody
Gene ID (Entrez)	315291, 904
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human Cyclin T1. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

1,414

Invitrogen™ EGR1 Recombinant Rat Monoclonal Antibody (HEGR1DS)

Rat Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rat
Conjugate	Unconjugated
Applications	Flow Cytometry,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P18146
Isotype	IgG2a
Concentration	1 mg/mL
Antigen	EGR1
Gene Symbols	EGR1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	A530045N19Rik; AT225; early growth response 1; early growth response protein 1; egr; EGR1; EGR-1; ETR103; G0S30; Krox-1; Krox24; Krox-24; Krox-24 nuclear protein; Nerve growth factor-induced protein A; Ngf1; NGF1-A; Ngfi; NGFIA; NGFI-A; TIS8; transcription factor ETR103; Transcription factor Zif268; Zenk; Zfp-6; Zif268; zif-268; Zinc finger protein 225; zinc finger protein Krox-24; ZNF225
Gene	EGR1
Product Type	Antibody
Gene ID (Entrez)	1958
Formulation	PBS with 0.09% sodium azide; pH 7.4
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HEGR1DS

1,415

MAP2 Monoclonal Antibody (AP20), Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4° C
Target Species	Bovine,Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Isotype	IgG1
Gene Accession No.	P11137
Concentration	0.2 mg/mL
Antigen	MAP2
Gene Symbols	Map2
Regulatory Status	RUO
Gene Alias	a730034c02; AC091465.1; DKFZp686I2148; G1-397-34; MAP 2; Map2; MAP-2; map2.S; map2a; map-2a; map2ab; MAP2B; MAP2C; MAP2R; microtubule associated protein 2; microtubule associated protein 2 S homeolog; microtubule associated protein 2; microtubule-associated protein 2; microtubule associated protein 2C; microtubule-associated protein 2; microtubule-associated protein-2; Mtap2; Mtap-2; OTTHUMP00000163916; OTTHUMP00000208143; repro4; XELAEV_18047318mg; xmap2
Gene	Map2
Product Type	Antibody
Gene ID (Entrez)	281294, 4133
Formulation	tissue culture supernatant with 0.09% sodium azide
Classification	Monoclonal
Primary or Secondary	Primary
Clone	AP20

1,416

Invitrogen™ NCOA4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q13772
Isotype	IgG
Concentration	1.67 mg/mL
Antigen	NCOA4
Gene Symbols	NCOA4
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	70 kDa androgen receptor coactivator; 70 kDa AR-activator; Androgen receptor coactivator 70 kDa protein; Androgen receptor-associated protein of 70 kDa; ARA70; ELE1; NCOA4; NCoA-4; Nuclear receptor coactivator 4; PTC3; ret fused; RET-activating gene ELE1; Ret-activating protein ELE1; RFG
Gene	NCOA4
Product Type	Antibody
Gene ID (Entrez)	27057, 619385, 8031
Formulation	PBS with 50% glycerol and 0.09% sodium azide; pH 7.3
Immunogen	Recombinant protein (or fragment).
Classification	Polyclonal
Primary or Secondary	Primary

1,417

Invitrogen™ Complement Factor I Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Western Blot
Form	Liquid
Gene Accession No.	P05156, Q61129
Isotype	IgG
Concentration	1.08 mg/mL
Antigen	Complement Factor I
Gene Symbols	CFI
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	AHUS3; ARMD13; C3B/C4B inactivator; C3BINA; C3b-INA; C3b-inactivator; Cfi; complement component factor i; complement component I; complement control protein factor I; complement factor I; Complement factor I heavy chain; Complement factor I light chain; factor i; FI; IF; KAF; Konglutinogen-activating factor; light chain of factor I
Gene	CFI
Product Type	Antibody
Gene ID (Entrez)	12630, 3426
Formulation	PBS with 50% glycerol and 0.02% sodium azide; pH 7.3
Immunogen	Recombinant protein (or fragment).
Classification	Polyclonal
Primary or Secondary	Primary

1,418

Invitrogen™ MVP Monoclonal Antibody (1032)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Gel Shift,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form	Liquid
Gene Accession No.	Q14764, Q62667
Isotype	IgG1 κ
Concentration	0.2 mg/mL
Antigen	MVP
Gene Symbols	MVP
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	2310009M24Rik; LRP; Lung resistance-related protein; major vault protein; MVP; MVP1; Testicular Secretory Protein Li 30; VAULT1; vRNP
Gene	MVP
Product Type	Antibody
Gene ID (Entrez)	64681, 9961
Formulation	PBS with 0.05% BSA and 0.05% sodium azide; pH 7.4
Immunogen	Proteins precipitated with AER317 from the phosphocellulose column flow through of extract of human breast cancer MCF-7 cells.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	1032

1,419

Invitrogen™ INSR beta Monoclonal Antibody (CT-1)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Affinity Purification,ELISA,Flow Cytometry,Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P06213, P15127, P15208
Isotype	IgG1 κ
Concentration	0.2 mg/mL
Antigen	INSR beta
Gene Symbols	INSR
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	4932439J01Rik; CD220; CD220 beta; CD221; D630014A15Rik; HHF5; IGF-I receptor; Insr; Insulin receptor; insulin receptor preproprotein; Insulin receptor subunit alpha; Insulin receptor subunit beta; IR; IR beta; IR-A; IR-B
Gene	INSR
Product Type	Antibody
Gene ID (Entrez)	16337, 24954, 3643
Formulation	PBS with 0.2% BSA and 0.09% sodium azide; pH 7.4
Immunogen	A 15-mer synthetic peptide corresponding to aa Tyr-KKNGRILTLPRSNPS from the C-terminal of human insulin receptor beta-subunit (aa 1368-1382).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	CT-1

1,420

Invitrogen™ CD81 Monoclonal Antibody (1.3.3.22)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Functional Assay,Immunohistochemistry (Frozen),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P60033, Q62745
Isotype	IgG1 κ
Concentration	0.2 mg/mL
Antigen	CD81
Gene Symbols	CD81
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	26 kDa cell surface protein TAPA-1; CD 81 antigen; Cd81; CD81 antigen; CD81 antigen (target of antiproliferative antibody 1); CD81 molecule; CVID6; S5.7; Tapa1; Tapa-1; Target of the antiproliferative antibody 1; Tetraspanin28; tetraspanin-28; Tspan28; Tspan-28
Gene	CD81
Product Type	Antibody
Gene ID (Entrez)	25621, 975
Formulation	PBS with 0.05% BSA and 0.05% sodium azide; pH 7.4
Immunogen	B cell line derived from a Burkitt lymphoma.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	1.3.3.22

1,421

Invitrogen™ INPP4B Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O15327, Q6P1Y8, Q9QWG5
Isotype	IgG
Concentration	1 mg/mL
Antigen	INPP4B
Gene Symbols	INPP4B
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	D-myo-inositol-3,4-bisphosphate 4-phosphohydrolase; E130107I17Rik; inositol polyphosphate 4-phosphatase II; 4-phosphatase II; inositol polyphosphate 4-phosphatase type II; inositol polyphosphate 4-phosphatase type II beta isoform; inositol polyphosphate-4-phosphatase type II 105kD; inositol polyphosphate-4-phosphatase type II B; inositol polyphosphate-4-phosphatase, type II; inositol polyphosphate-4-phosphatase, type II, 105kD; inositol polyphosphate-4-phosphatase, type II, 105kDa; Inpp4b; phosphatidylinositol-3,4-bisphosphate 4-phosphatase; phosphoinositide 4-phosphatase; type II inositol 3,4-bisphosphate 4-phosphatase; type II inositol-3,4-bisphosphate 4-phosphatase
Gene	INPP4B
Product Type	Antibody
Gene ID (Entrez)	116699, 234515, 8821
Formulation	PBS with 0.02% sodium azide
Immunogen	INPP4B antibody for a 17 amino acid peptide near the amino terminus of human INPP4B. The immunogen is within the last 50 amino acids of INPP4B.
Classification	Polyclonal
Primary or Secondary	Primary

1,422

Apolipoprotein E/ApoE Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing & Availability

1,423

Invitrogen™ EphB1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P09759, P54762, Q8CBF3
Isotype	IgG
Concentration	500 μg/mL
Antigen	EphB1
Gene Symbols	EPHB1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	9330129L11; AW488255; C130099E04Rik; Cek6; EK6; ELK; Elkh; ELK-related protein tyrosine kinase; ENSMUSG00000074119; Eph receptor B1; Eph receptor B2 (ELK-related protein tyrosine kinase); eph tyrosine kinase 2; EPHB1; Ephb2; EPH-like kinase 6; Ephrin type-B receptor 1; EPHT2; Epth2; Erk; Hek6; NET; Neuronally-expressed EPH-related tyrosine kinase; soluble EPHB1 variant 1; tyrosine-protein kinase receptor EPH-2
Gene	EPHB1
Product Type	Antibody
Gene ID (Entrez)	2047, 24338, 270190
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE).
Classification	Polyclonal
Primary or Secondary	Primary

1,424

Invitrogen™ NPAS4 Monoclonal Antibody (N408/79)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (PFA fixed),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q8BGD7, Q8CJH6, Q8IUM7
Isotype	IgG1
Concentration	1 mg/mL
Antigen	NPAS4
Gene Symbols	NPAS4
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	bHLH PAS type transcription factor NXF; bHLHe79; bHLH-PAS type transcription factor NXF; Class E basic helix-loop-helix protein 79; HLH-PAS transcription factor NXF; LE-PAS; Limbic-enhanced PAS protein; neuronal PAS domain protein 4; neuronal PAS domain-containing protein 4; Neuronal PAS4; Npas4; NXF; PAS domain-containing protein 10; PASD10; PASD10 and LE-PAS
Gene	NPAS4
Product Type	Antibody
Gene ID (Entrez)	225872, 266734, 266743
Formulation	PBS with 50% glycerol and 0.1% sodium azide; pH 7.4
Immunogen	Fusion protein amino acids 597-802 (C-terminus) of rat Npas4.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	N408/79

1,425

Invitrogen™ Desmin Monoclonal Antibody (D33)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Bovine,Canine,Chicken,Feline,Hamster,Human,Monkey,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O62654, P02542, P17661, P48675, Q5XFN2
Isotype	IgG1 κ
Concentration	0.2 mg/mL
Antigen	Desmin
Gene Symbols	DES
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	CMD1I; CSM1; CSM2; DES; Desmin; desmin-like protein; FLJ12025; FLJ39719; FLJ41013; FLJ41793; I79_018932; intermediate filament protein; LGMD2R; MFM1; muscle-specific intermediate filament desmin; muscle-specific intermediate filament protein; mutant desmin p.K241E; SCPNK; similar to desmin
Gene	DES
Product Type	Antibody
Gene ID (Entrez)	100764990, 101097010, 1674, 280765, 395906, 497091, 64362
Formulation	PBS with 0.05% BSA and 0.05% sodium azide; pH 7.4
Immunogen	Desmin from human muscle.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	D33

Prev
1
...
93
94
95
96
...
104,698
Next

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ Phospho-Histone H3 (Ser10) Monoclonal Antibody (K.872.3) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD11c Monoclonal Antibody (N418), Brilliant Violet™ 605, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Cyclin T1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NCOA4 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Complement Factor I Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MVP Monoclonal Antibody (1032) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ INSR beta Monoclonal Antibody (CT-1) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD81 Monoclonal Antibody (1.3.3.22) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ INPP4B Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Apolipoprotein E/ApoE Antibody - BSA Free, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Invitrogen™ EphB1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NPAS4 Monoclonal Antibody (N408/79) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Desmin Monoclonal Antibody (D33) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-Histone H3 (Ser10) Monoclonal Antibody (K.872.3)

Invitrogen™ CD11c Monoclonal Antibody (N418), Brilliant Violet™ 605, eBioscience™

Invitrogen™ Cyclin T1 Polyclonal Antibody

Invitrogen™ NCOA4 Polyclonal Antibody

Invitrogen™ Complement Factor I Polyclonal Antibody

Invitrogen™ MVP Monoclonal Antibody (1032)

Invitrogen™ INSR beta Monoclonal Antibody (CT-1)

Invitrogen™ CD81 Monoclonal Antibody (1.3.3.22)

Invitrogen™ INPP4B Polyclonal Antibody

Apolipoprotein E/ApoE Antibody - BSA Free, Novus Biologicals™

Invitrogen™ EphB1 Polyclonal Antibody

Invitrogen™ NPAS4 Monoclonal Antibody (N408/79)

Invitrogen™ Desmin Monoclonal Antibody (D33)