All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (901)
- (1,756)
- (4,347)
- (1)
- (1)
- (3)
- (1)
- (1,205)
- (1,717)
- (803,173)
- (21,376)
- (2)
- (730)
- (60)
- (1)
- (29)
- (5,029)
- (3,330)
- (1,831)
- (213)
- (1)
- (8,787)
- (11,941)
- (2,264)
- (4)
- (3)
- (13)
- (67)
- (5)
- (33)
- (1)
- (2,890)
- (3,718)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,591)
- (466)
- (1)
- (1)
- (136)
- (236)
- (3)
- (1)
- (3)
- (13)
- (97)
- (1)
- (162,045)
- (202,050)
- (1)
- (22)
- (798)
- (2)
- (10,986)
- (8)
- (3)
- (134)
- (2)
- (4)
- (11)
- (4)
- (9)
- (1)
- (2)
- (5)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (11)
- (19)
- (5)
- (1)
- (1)
- (10,801)
- (587)
- (1)
- (2)
- (1)
- (1)
- (9)
- (1)
- (2)
- (2)
- (321)
- (360)
- (5)
- (13,428)
- (2)
- (4,709)
- (2,250)
- (1)
- (14)
- (1)
- (1)
- (7)
- (5,619)
- (3,967)
- (1)
- (18)
- (1)
- (1)
- (2)
- (17,459)
- (16,539)
- (25)
- (1)
- (1)
- (2)
- (5,469)
- (7)
- (3)
- (33)
- (4)
- (13)
- (73)
- (579)
- (17)
- (2)
- (2)
- (1)
- (12)
- (1)
- (1)
- (1)
- (2,083)
- (1)
- (14)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (2)
- (104)
- (1)
- (3,890)
- (2)
- (20)
- (3)
- (108)
- (1)
- (1)
- (5)
- (1)
- (1)
- (5)
- (195)
- (2)
- (4,818)
- (11)
- (2)
- (5)
- (9)
- (4)
- (17)
- (27)
- (105)
- (7,535)
- (34,944)
- (1,381)
- (53)
- (1,544)
- (3)
- (25)
- (7)
- (1)
- (2,013)
- (1)
- (4,335)
- (41)
- (3)
- (2)
- (3)
- (1)
- (1)
- (4)
- (37)
- (1)
- (1)
- (685)
- (1)
- (1)
- (2)
- (4)
- (6)
- (3)
- (6)
- (1)
- (1)
- (565)
- (2,590)
- (38)
- (1)
- (15)
- (1,621)
- (726)
- (2)
- (2)
- (6)
- (4)
- (5)
- (93,315)
- (62)
- (116)
- (1,916)
- (14,350)
- (3)
- (2)
- (92)
- (2)
- (4)
- (186)
- (8)
- (23)
- (510,565)
- (12)
- (1)
- (678,907)
- (72,323)
- (3)
- (37,857)
- (170)
- (1)
- (1)
- (28,749)
- (9)
- (1)
- (25)
- (2,809)
- (74)
- (89)
- (275)
- (2)
- (51)
- (29,161)
- (28,692)
- (5)
- (29,910)
- (12)
- (28,964)
- (45)
- (92)
- (47)
- (29,214)
- (1)
- (29,793)
- (1)
- (3)
- (1)
- (70)
- (29,166)
- (29,162)
- (132)
- (115)
- (31)
- (149)
- (19)
- (125)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (32,906)
- (11)
- (3)
- (223)
- (764)
- (1,050)
- (712)
- (763)
- (904)
- (876)
- (1,005)
- (845)
- (1,474)
- (902)
- (830)
- (1,051)
- (1,051)
- (1,047)
- (675)
- (1,072)
- (30,336)
- (107)
- (16)
- (50)
- (19)
- (1)
- (147)
- (1)
- (175)
- (3)
- (122)
- (27,683)
- (27,740)
- (28,112)
- (63)
- (27,746)
- (23,745)
- (1)
- (60)
- (27,683)
- (27,328)
- (27,280)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (31,796)
- (5)
- (30)
- (1)
- (1)
- (338)
- (725)
- (28,695)
- (1)
- (30,785)
- (25,905)
- (17,685)
- (17,678)
- (25,882)
- (30,789)
- (38)
- (1)
- (46)
- (9)
- (12)
- (2)
- (103)
- (11)
- (22)
- (58)
- (26)
- (132)
- (171)
- (25)
- (90)
- (58)
- (14)
- (56)
- (74)
- (9)
- (78)
- (83)
- (99)
- (88)
- (90)
- (16)
- (64)
- (66)
- (42)
- (58)
- (50)
- (53)
- (108)
- (134)
- (41)
- (68)
- (65)
- (88)
- (72)
- (454)
- (30,080)
- (7)
- (4)
- (313)
- (387)
- (2,716)
- (3,642)
- (2)
- (3)
- (36)
- (208)
- (2,606)
- (94)
- (31)
- (26,310)
- (514)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (869)
- (147)
- (795)
- (824)
- (420)
- (347)
- (805)
- (35)
- (712)
- (717)
- (781)
- (743)
- (778)
- (629)
- (763)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (12)
- (5)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (470,029)
- (7)
- (266)
- (49)
- (2)
- (366)
- (69)
- (46)
- (25)
- (270)
- (3)
- (3)
- (4)
- (29,299)
- (29,325)
- (29,280)
- (2)
- (20)
- (23)
- (114)
- (798)
- (472)
- (92)
- (5)
- (1,022)
- (2)
- (1)
- (4)
- (115)
- (9)
- (1)
- (6,330)
- (1,297)
- (1)
- (27)
- (2)
- (5,545)
- (174)
- (460)
- (157)
- (6)
- (3)
- (15)
- (27)
- (1)
- (1)
- (269)
- (25)
- (21)
- (63,458)
- (2)
- (1)
- (109)
- (279)
- (175)
- (2,639)
- (3)
- (2)
- (1,000)
- (38)
- (381,326)
- (14,587)
- (14,076)
- (9,923)
- (60)
- (25)
- (210)
- (9)
- (2)
- (2)
- (1)
- (2)
- (286,045)
- (358)
- (10,564)
- (8)
- (9)
- (6)
- (1)
- (1)
- (4)
- (43)
- (13,176)
- (35)
- (2)
- (1)
- (2)
- (193)
- (207)
- (8,442)
- (76)
- (4)
- (2)
- (2)
- (104)
- (3)
- (2)
- (2)
- (10)
- (19)
- (64)
- (36)
- (3,255)
- (2,113)
- (227,456)
- (74,335)
- (159)
- (54)
- (187,131)
- (403,747)
- (77)
- (918)
- (30,236)
- (40)
- (12,806)
- (379,495)
- (32)
- (101)
- (441)
- (107,698)
- (703)
- (26)
- (11)
- (51)
- (328)
- (22)
- (312)
- (447)
- (261)
- (1,104)
- (2)
- (26)
- (5,567)
- (1)
- (678)
- (5)
- (6)
- (129)
- (1)
- (302)
- (9)
- (728)
- (2)
- (1,065)
- (42)
- (171)
- (6)
- (6)
- (34,631)
- (1)
- (833)
- (16)
- (1,669)
- (22)
- (2)
- (8,649)
- (2)
- (1)
- (434)
- (3)
- (111)
- (1)
- (1,390)
- (18)
- (6)
- (19)
- (1,626)
- (1)
- (1,462)
- (807)
- (663)
- (41)
- (2,666)
- (468)
- (94)
- (7)
- (14)
- (20)
- (7)
- (2,112)
- (242)
- (1)
- (1)
- (1)
- (29)
- (5)
- (2)
- (1)
- (1)
- (924,857)
- (3)
- (2,413)
- (19)
- (1)
- (22)
- (22)
- (32)
- (136)
- (29)
- (5)
- (1,450)
- (109)
- (24)
- (712)
- (21)
- (4)
- (22)
- (734)
- (2,033)
- (28)
- (2)
- (4,512)
- (399)
- (1)
- (4)
- (25)
- (1)
- (1)
- (20,881)
- (768)
- (2,586)
- (356)
- (32)
- (1,079)
- (1)
- (6)
- (34)
- (4)
- (34)
- (29,582)
- (609)
- (2)
- (1)
- (5)
- (1,341)
- (8,204)
- (300)
- (1,017)
- (9)
- (603)
- (4)
- (30)
- (3)
- (1)
- (817)
- (2)
- (1)
- (1)
- (3)
- (1,220)
- (2,357)
- (309)
- (1)
- (36)
- (2)
- (3)
- (4)
- (3)
- (6)
- (1,438)
- (8)
- (8)
- (4)
- (1,962)
- (131)
- (21)
- (1,220)
- (100)
- (2)
- (5)
- (7)
- (9)
- (7,913)
- (78)
- (12)
- (1)
- (3,980)
- (65)
- (565)
- (191)
- (1)
- (72)
- (1)
- (1,300)
- (33)
- (4)
- (2)
- (9)
- (499)
- (21)
- (297)
- (3)
- (3)
- (135)
- (145)
- (1)
- (1,815)
- (39)
- (112)
- (27)
- (3)
- (175)
- (36)
- (6,746)
- (96)
- (269)
- (1)
- (236)
- (204)
- (177)
- (136)
- (2)
- (5)
- (4,201)
- (191)
- (12)
- (1)
- (2)
- (24)
- (7)
- (45)
- (1)
- (28)
- (638)
- (1,209,836)
- (481)
- (6)
- (3)
- (1)
- (257)
- (46)
- (13)
- (4)
- (145)
- (197)
- (331)
- (385)
- (30)
- (97)
- (4)
- (13)
- (20)
- (1)
- (24)
- (2)
- (13)
- (26)
- (18)
- (417)
- (8)
- (1)
- (859)
- (988)
- (2)
- (8)
- (4)
- (13)
- (78)
- (4)
- (156)
- (1)
- (10)
- (19,539)
- (52)
- (5)
- (1)
- (490,144)
- (3,557)
- (418)
- (1)
- (347)
- (2)
- (7)
- (31)
- (823)
- (3,918)
- (9)
- (17)
- (1,235)
- (227)
- (112)
- (213)
- (71)
- (1)
- (3)
- (13)
- (20)
- (50)
- (5)
- (9)
- (17)
- (189)
- (18)
- (17,477)
- (18)
- (132)
- (24)
- (1,065)
- (6)
- (1)
- (3)
- (1)
- (3)
- (498)
- (5)
- (14,291)
- (82)
- (360)
- (5)
- (46)
- (2)
- (12,361)
- (344)
- (2)
- (10)
- (293,902)
- (3,836)
- (6)
- (283)
- (14)
- (1,482)
- (1,104)
- (5)
- (30)
- (12)
- (32)
- (54)
- (1)
- (149)
- (30)
- (11)
- (2)
- (813)
- (2)
- (4,237)
- (2)
- (1)
- (13)
- (14)
- (1)
- (1)
- (13)
- (1)
- (13)
- (3,702)
- (238)
- (1)
- (2)
- (16)
- (6)
- (6)
- (8)
- (48)
- (3)
- (1)
- (4)
- (53)
- (2)
- (20)
- (42)
- (8)
- (71)
- (1,383)
- (8)
- (23)
- (2)
- (4)
- (193)
- (1)
- (1,159)
- (17,187)
- (51)
- (2)
- (1)
- (1)
- (111)
- (165)
- (1,867)
- (1,921)
- (5)
- (2)
- (5,517)
- (3)
- (9)
Filtered Search Results
Invitrogen™ HDAC1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Canine,Hamster,Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ChIP Assay,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O09106, Q13547, Q4QQW4 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | HDAC1 |
| Gene Symbols | HDAC1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | DKFZp686H12203; GON-10; HD1; Hdac1; Hdac1-ps; Histone deacetylase 1; histone deacetylase 1-like protein; MommeD5; reduced potassium dependency, yeast homolog-like 1; RP4-811H24.2; RPD3; RPD3L1 |
| Gene | HDAC1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 100752721, 297893, 3065, 433759, 487309 |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
| Immunogen | Synthetic peptide corresponding to residues C E(467) E K P E A K G V K E E V K L A(482) of human HDAC1. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Norovirus VP1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Virus |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Liquid |
| Isotype | IgG |
| Concentration | 1.02 mg/mL |
| Antigen | Norovirus VP1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | Norovirus |
| Product Type | Antibody |
| Formulation | PBS with 20% glycerol and 0.025% ProClin 300; pH 7 |
| Immunogen | Recombinant protein encompassing a sequence within the center region of Norovirus VP1 (GII. 17) (Norovirus (Hu/GII/CN/2014/GII.17/1401169)). The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ DYKDDDDK Tag Monoclonal Antibody (FG4R), HRP
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | 4°C |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | HRP |
| Applications | Western Blot |
| Form | Liquid |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | DYKDDDDK Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | DDDDK; DDDDK epitope tag; ECS epitope tag; ECS tag; FLAG; FLAG Tag |
| Product Type | Antibody |
| Formulation | PBS with 0.07% Kathon |
| Immunogen | Synthetic peptide (DYKDDDDK) coupled to KLH. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | FG4R |
Invitrogen™ CaMKII alpha Monoclonal Antibody (6G9)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunoprecipitation,Western Blot |
| Form | Liquid |
| Gene Accession No. | P11275, P11798 |
| Isotype | IgG1 |
| Concentration | 1.17 mg/mL |
| Antigen | CaMKII alpha |
| Gene Symbols | CAMK2A |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | alpha CaM kinase II; alpha-CaMKII; Ca2+/calmodulin-dependent protein kinase II; Ca2+/calmodulin-dependent protein kinase II alpha; Calci; calcium/calmodulin dependent protein kinase II alpha; calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha; calcium/calmodulin-dependent protein kinase II alpha; calcium/calmodulin-dependent protein kinase II alpha subunit; calcium/calmodulin-dependent protein kinase II alpha-B subunit; calcium/calmodulin-dependent protein kinase type II alpha chain; calcium/calmodulin-dependent protein kinase type II subunit alpha; CaM kinase II alpha subunit; caM kinase II subunit alpha; CaMK II; CAMK2; Camk2a; CAMKA; CaMKII; CaMK-II alpha subunit; caMK-II subunit alpha; CaMKIINalpha; CaM-kinase II alpha chain; EC 2.7.11.17; KIAA0968; mKIAA0968; OTTHUMP00000165787; OTTHUMP00000165788; Phospho-CaMKI; PK2CDD; PKCCD; R74975 |
| Gene | CAMK2A |
| Product Type | Antibody |
| Gene ID (Entrez) | 12322, 25400 |
| Formulation | PBS with 0.05% sodium azide |
| Immunogen | Partially purified, rat CaM kinase II. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 6G9 |
Invitrogen™ Hepatitis B Virus X Monoclonal Antibody (X36C)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Virus |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunoprecipitation,Western Blot |
| Form | Liquid |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | Hepatitis B Virus X |
| Regulatory Status | RUO |
| Purification Method | HPLC |
| Gene Alias | HBV; HBVgp3; HepB; HepB X |
| Product Type | Antibody |
| Formulation | PBS with 0.05% sodium azide |
| Immunogen | Baculovirus expressed recombinant HBx. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | X36C |
Invitrogen™ EEA1 Monoclonal Antibody (F.43.1)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Monoclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | Q15075, Q8BL66 |
| Isotype | IgG |
| Concentration | 44 μg/mL |
| Antigen | EEA1 |
| Gene Symbols | EEA1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | A430109M19Rik; B230358H09Rik; Early endosome antigen 1; early endosome antigen 1, 162kD; early endosome-associated protein; EEA1; Endosome-associated protein p162; MST105; MSTP105; ZFYVE2; Zinc finger FYVE domain-containing protein 2 |
| Gene | EEA1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 216238, 314764, 8411 |
| Formulation | 0.01M HEPES with 0.15M NaCl, 100 μg/mL BSA, 50% glycerol and <0.02% sodium azide, pH 7.5 |
| Immunogen | Synthetic peptide corresponding to residues surrounding Ser70 of human EEA1 protein. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | F.43.1 |
Invitrogen™ CD206 Monoclonal Antibody (MR5D3), FITC
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. Store in the dark. |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | FITC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | Q61830 |
| Isotype | IgG2a |
| Concentration | 0.1 mg/mL |
| Antigen | CD206 |
| Gene Symbols | Mrc1 |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | AW259686; bA541I19.1; CD206; CELE_Y39A3CR.4; CLEC13D; CLEC13DL; C-type lectin domain family 13 member D; C-type lectin domain family 13 member D-like; ddp-1; hMR; Human mannose receptor; macrophage mannose receptor 1; Macrophage mannose receptor 1-like protein 1; mannose receptor, C type 1; mannose receptor, C type 1-like 1; Mitochondrial import inner membrane translocase subunit Tim8; MMR; MR; MRC1; MRC1L1; tim-8; Y39A3CR.4 |
| Gene | Mrc1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 17533 |
| Formulation | PBS with 1% BSA and 0.09% sodium azide |
| Immunogen | Chimaeric CRD4-7-Fc protein. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | MR5D3 |
Invitrogen™ CD45 Monoclonal Antibody (K252.1E4), FITC
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. Store in the dark. |
|---|---|
| Target Species | Pig |
| Host Species | Mouse |
| Conjugate | FITC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | 0 |
| Isotype | IgG1 |
| Concentration | 0.1 mg/mL |
| Antigen | CD45 |
| Gene Symbols | PTPRC |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | B220; cd45; CD45 antigen; CD45 antigen isoform 1 precursor; CD45 antigen isoform 2 precursor; CD45 antigen isoform 3 precursor; CD45 antigen isoform 4 precursor; CD45 antigen isoform 5 precursor; CD45 antigen isoform 6 precursor; CD45R; GP180; Lca; L-CA; leucocyte common antigen; leukocyte common antigen; leukocyte common antigen A; leukocyte common antigen B; leukocyte common antigen, CD45; loc; LOW QUALITY PROTEIN: receptor-type tyrosine-protein phosphatase C; LY5; Ly-5; lymphocyte antigen 5; lymphocyte common antigen; Lyt-4; membrane tyrosine phosphatase; protein tyrosine phosphatase lambda; protein tyrosine phosphatase receptor type C; protein tyrosine phosphatase, receptor type C; protein tyrosine phosphatase, receptor type, C; protein tyrosine phosphatase, receptor type, c polypeptide; Protein tyrosine phosphatase, receptor-type, c polypeptide; protein tyrosine phosphatase; alternatively spliced; Ptprc; Receptor-type tyrosine-protein phosphatase C; RT7; T200; T200 glycoprotein; T200 leukocyte common antigen; T220 and B220 |
| Gene | PTPRC |
| Product Type | Antibody |
| Gene ID (Entrez) | 100522631 |
| Formulation | PBS with 1% BSA and 0.09% sodium azide |
| Immunogen | Porcine Peripheral Blood lymphocytes. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | K252.1E4 |
Invitrogen™ PSAT1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | Q99K85, Q9Y617 |
| Isotype | IgG |
| Concentration | 0.23 mg/mL |
| Antigen | PSAT1 |
| Gene Symbols | PSAT1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | D8Ertd814e; endometrial progesterone-induced protein; EPIP; NLS2; Phosphohydroxythreonine aminotransferase; phosphoserine aminotransferase; phosphoserine aminotransferase 1; PSA; Psa1; Psat; Psat1; PSATD |
| Gene | PSAT1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 107272, 29968 |
| Formulation | PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7 |
| Immunogen | Recombinant protein encompassing a sequence within the center region of human PSAT1. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Lipid A LPS Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Bacteria |
| Host Species | Goat |
| Conjugate | Unconjugated |
| Applications | Immunocytochemistry,Immunocytochemistry,Immunohistochemistry,Western Blot |
| Form | Liquid |
| Isotype | IgG |
| Concentration | 5 mg/mL |
| Antigen | Lipid A LPS |
| Regulatory Status | RUO |
| Purification Method | IgG fraction |
| Gene Alias | Lipid A Lipopolysaccharide |
| Product Type | Antibody |
| Formulation | PBS with 0.1% sodium azide; pH 7.2 |
| Immunogen | Whole cell prep of Lipid A from E. coli O157. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ alpha Tubulin Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Chicken Polyclonal Antibody
| Content And Storage | 4°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Chicken |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Liquid |
| Gene Accession No. | A6NHL2, P05213, P0DPH7, P68363, P68366, P68368, P68369, P68370, P68373, Q3KRE8, Q3UX10, Q5XIF6, Q6AYZ1, Q6P9V9, Q6PEY2, Q71U36, Q9BQE3, Q9BVA1, Q9CWF2 |
| Isotype | IgY |
| Concentration | 1 mg/mL |
| Antigen | alpha Tubulin |
| Gene Symbols | Tuba1a, Tuba1b, TUBA1C, TUBA3C, TUBA3E, TUBA4A, TUBAL3, TUBB2B |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 1t; a1t; ALPHA 84C; alpha tubulin; alpha tubulin 84B; alpha[[1]] tubulin; alpha[[1]]-tubulin; alpha1; alpha1 tubulin; alpha1t; alpha1tub; alpha1tub84B; alpha1-tubulin; alpha84B; alphaT; alphat-1; alphatub; alpha-tub; alphaTub1; alphatub84; alphaTUB84B; alpha-tub84B; alphaTub84B-PA; alphatubulin; alpha-tubulin; Alpha-tubulin 1; Alpha-tubulin 2; Alpha-tubulin 3; Alpha-tubulin 3C; alpha-tubulin 3C/D; Alpha-tubulin 3D; Alpha-tubulin 3E; alpha-tubulin 4; Alpha-tubulin 6; alphaTubulin 84B; alpha-tubulin 84B; alpha-Tubulin at 84B; alpha-tubulin I; Alpha-tubulin II; alpha-tubulin III; Alpha-tubulin isotype M-alpha-1; alpha-tubulin isotype M-alpha-2; Alpha-tubulin isotype M-alpha-4; alpha-tubulin isotype M-alpha-6; alpha-tubulin TUB1; alpha-tubulin ubiquitous; alphaTubulin84B; Alpha-Tubulin84B; ALS22; anon-EST:Liang-1.59; anon-EST:Liang-2.30; AT25469p; aTub84B; a-tub84B; bA408E5.3; B-ALPHA-1; bcm948; BEST:LD32507; cb944; CG1913; CG1913-PA; chr3R:2914276..2914416; clone 1.59; clone 2.30; Detyrosinated tubulin alpha-1A chain; Detyrosinated tubulin alpha-1B chain; Detyrosinated tubulin alpha-1C chain; Detyrosinated tubulin alpha-3 chain; Detyrosinated tubulin alpha-3C chain; Detyrosinated tubulin alpha-3D chain; Detyrosinated tubulin alpha-3E chain; DM1alpha; Dmel\CG1913; Dmel_CG1913; DTA1; fb22g06; FLJ30169; H2 ALPHA; H2-ALPHA; hum-a-tub1; hum-a-tub2; I79_019110; K-ALPHA-1; l(3)84Bd; l(3)g3; lis3; LOC100726777; LOC100731885; LOC100857858; LOC101118307; LOC106557476; M[a]4; M[a]6; ms(3)nc33; nc33; RGD1565476; similar to alpha-tubulin isoform 1; similar to tubulin alpha 1; T; Talpha1; Talpha1 alpha-tubulin; TBA1_DROME; Testis-specific alpha-tubulin; Tub; Tub 84B; TUB1; Tub1C; Tub84B; TUBA1; Tuba-1; tuba1 protein; TUBA1/3/4; Tuba1a; tuba1a.L; tuba1a-a; tuba1a-b; TUBA1B; TUBA1C; tuba1l; tuba1l2; TUBA2; TUBA3; TUBA3C; TUBA3D; TUBA3E; Tuba4; Tuba4a; TUBA5; Tuba6; tuba8.S; tubA84B; tubal2; Tubalpha1; tubulin; tubulin 1 alpha-chain; tubulin 1alpha; tubulin alpha; tubulin alpha 1a; tubulin alpha 1a L homeolog; tubulin alpha 1b; tubulin alpha 1c; tubulin alpha 3; tubulin alpha 3c; tubulin alpha 3e; tubulin alpha 4a; tubulin alpha 6; tubulin alpha 8 S homeolog; tubulin alpha1; tubulin alpha-1 chain; tubulin alpha1 promoter; Tubulin alpha-1A chain; tubulin alpha-1B chain; Tubulin alpha-1C chain; tubulin alpha-1C chain-like; tubulin alpha-2 chain; Tubulin alpha-3 chain; Tubulin alpha-3C chain; tubulin alpha-3C/D chain; Tubulin alpha-3D chain; Tubulin alpha-3E chain; tubulin alpha-4 chain; Tubulin alpha-4A chain; Tubulin alpha-5 chain; tubulin alpha-5 chain-like; tubulin alpha-6 chain; tubulin alpha-8 chain; tubulin alpha-ubiquitous chain; tubulin B-alpha-1; Tubulin H2-alpha; tubulin K-alpha-1; tubulin(alpha1); tubulin, alpha 1; tubulin, alpha 1 (testis specific); tubulin, alpha 1, like; tubulin, alpha 1, like 2; tubulin, alpha 1a; tubulin, alpha 1b; tubulin, alpha 1c; tubulin, alpha 2; tubulin, alpha 3c; tubulin, alpha 3e; tubulin, alpha 4; tubulin, alpha 4a; tubulin, alpha 5; tubulin, alpha 6; tubulin, alpha, brain-specific; tubulin, alpha, ubiquitous; tubulin1alpha; tubulin84B; Tubulin-alpha1; Unknown (protein for MGC:133894); unnamed protein product; wu:fb22g06; wu:fb37a10; XELAEV_18019849mg; XELAEV_18020901mg; YML085C |
| Gene | TUBAL3 |
| Product Type | Antibody |
| Gene ID (Entrez) | 10376, 112714, 22142, 22143, 22145, 22146, 238463, 291081, 291287, 300218, 316531, 347733, 500929, 64158, 7277, 7278, 73710, 7846, 79861, 84790 |
| Formulation | PBS with 0.02% sodium azide |
| Immunogen | A 16 amino acid synthetic peptide near the amino terminus of human Tubulin. The immunogen is located within amino acids 140-190 of Alpha-tubulin. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ APE1 Monoclonal Antibody (13B 8E5C2)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse,Rat,Canine,Monkey |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ChIP Assay,Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,RNA Immunoprecipitation,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P27695, P28352, P43138 |
| Isotype | IgG2a |
| Concentration | 1 mg/mL |
| Antigen | APE1 |
| Gene Symbols | APEX1 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | AP endonuclease 1; AP endonuclease class I; AP lyase; Ape; APE1; APEN; Apex; APEX nuclease; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX nuclease 1; Apex1; apurinic/a; Apurinic/apy; apurinic/apyrimidinic (abasic) endonuclease; apurinic/apyrimidinic endodeoxyribonuclease 1; apurinic/apyrimidinic endonuclease; apurinic/apyrimidinic endonuclease 1; Apurinic-apyrimidinic endonuclease 1; APX; BAP 1; BAP1; deoxyribonuclease (apurinic or apyrimidinic); DNA-(apurinic or apyrimidinic site) endonuclease; DNA-(apurinic or apyrimidinic site) lyase; DNA-(apurinic or apyrimidinic site) lyase, mitochondrial; HAP1; protein REF-1; redox factor 1; redox factor-1; REF1; REF-1 |
| Gene | APEX1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11792, 328, 482558, 79116 |
| Formulation | PBS with 0.05% sodium azide |
| Immunogen | Full-length recombinant human APE protein. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 13B 8E5C2 |
Invitrogen™ SERCA2 ATPase Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Lyophilized |
| Gene Accession No. | O55143, P11507, P16615 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | SERCA2 ATPase |
| Gene Symbols | Atp2a2 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 9530097L16Rik; ATP2; Atp2a2; ATP2B; ATPase Ca++ transporting cardiac muscle slow twitch 2; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2; ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2; ATPase, Ca++ transporting, slow twitch 2; Ca(2+)-transport ATPase class 3; calcium ATPase; calcium pump 2; calcium-ATPase (EC 3.6.1.3); calcium-transporting ATPase; calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform; cardiac Ca2+ ATPase; D5Wsu150e; DAR; DD; endoplasmic reticulum class 1/2 Ca(2+) ATPase; mKIAA4195; putative SERCA isoform; sarco(endo)plasmic reticulum Ca(2+)-dependent ATPase 2; sarco/endoplasmic reticulum Ca2+-ATPase 2; sarcoplasmic reticulum Ca2+-transport ATPase isoform; sarcoplasmic/endoplasmic reticulum calcium ATPase 2; sarcoplasmic/endoplasmic-reticulum Ca(2+) pump gene 2; SERCA; SERCA ATPase; SERCA2; Serca2a; SERCA2B; SercaII; SR Ca(2+)-ATPase 2; unnamed protein product |
| Gene | Atp2a2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11938, 29693, 488 |
| Formulation | PBS with 4mg trehalose and no preservative |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA2 ATPase (1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ LDLR Recombinant Rabbit Monoclonal Antibody (SJ0197)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Western Blot,Immunocytochemistry,Western Blot,Western Blot |
| Form | Liquid |
| Gene Accession No. | P01130 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | LDLR |
| Gene Symbols | LDLR |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | FH; FHC; Hlb301; I79_005860; LDL receptor; LDLA; LDLCQ2; LDLR; ldl-r; LDLRA; low density lipoprotein receptor; low density lipoprotein receptor protein; low-density lipoprotein receptor; low-density lipoprotein receptor class A domain-containing protein 3 |
| Gene | LDLR |
| Product Type | Antibody |
| Gene ID (Entrez) | 3949 |
| Formulation | TBS with 0.05% BSA, 40% Glycerol and 0.05% sodium azide; pH 7.4 |
| Immunogen | Synthetic peptide within Human LDL Receptor aa 811-860. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SJ0197 |
Invitrogen™ IL-10 Monoclonal Antibody (16E3)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Unconjugated |
| Applications | ELISA,Western Blot |
| Form | Liquid |
| Gene Accession No. | P18893 |
| Isotype | IgG2b |
| Concentration | 1.0 mg/mL |
| Antigen | IL-10 |
| Gene Symbols | IL10 |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | CSIF; cytokine; Cytokine synthesis inhibitory factor; GVHDS; H-IL-10; il 10; IL10; IL-10; IL-10 precursor; IL10A; IL10X; ILN; Interleukin; interleukin 10; Interleukin10; interleukin-10; MGC126450; MGC126451; RP11-262N9.1; T-cell growth inhibitory factor; TGIF |
| Gene | IL10 |
| Product Type | Antibody |
| Gene ID (Entrez) | 16153 |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant mouse IL-10. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 16E3 |