All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (925)
- (1,939)
- (4,412)
- (1)
- (1)
- (3)
- (1)
- (1,258)
- (1,754)
- (921,451)
- (21,592)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,588)
- (3,360)
- (1,862)
- (218)
- (1)
- (8,787)
- (12,059)
- (2,271)
- (9)
- (51)
- (3)
- (4)
- (13)
- (2)
- (69)
- (5)
- (11)
- (12,287)
- (15,867)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,669)
- (535)
- (1)
- (1)
- (136)
- (422)
- (3)
- (1)
- (3)
- (16)
- (110)
- (1)
- (189,975)
- (288,095)
- (1)
- (19)
- (798)
- (1)
- (12,212)
- (2)
- (129)
- (1)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (12)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (19)
- (46)
- (1)
- (5)
- (1)
- (1)
- (10,751)
- (652)
- (1)
- (2)
- (1)
- (4)
- (6)
- (6)
- (1)
- (8)
- (3)
- (16)
- (2)
- (2)
- (329)
- (359)
- (5)
- (12,996)
- (2)
- (4,300)
- (2,250)
- (1)
- (14)
- (33)
- (1)
- (7)
- (1)
- (6,036)
- (3,901)
- (1)
- (20)
- (1)
- (1)
- (2)
- (40)
- (1)
- (2)
- (1)
- (17,537)
- (16,763)
- (18)
- (1)
- (1)
- (1)
- (5,545)
- (2)
- (2)
- (43)
- (4)
- (13)
- (1)
- (164)
- (748)
- (17)
- (2)
- (6)
- (1)
- (1)
- (2)
- (2,085)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (104)
- (1)
- (1)
- (3,862)
- (2)
- (20)
- (3)
- (112)
- (1)
- (1)
- (5)
- (2)
- (3)
- (33)
- (1)
- (5)
- (187)
- (2)
- (4,823)
- (12)
- (1)
- (2)
- (5)
- (9)
- (4)
- (7)
- (23)
- (130)
- (8,929)
- (39,658)
- (448)
- (53)
- (1,929)
- (1)
- (36)
- (7)
- (1)
- (2,681)
- (1)
- (4,476)
- (42)
- (2)
- (2)
- (1)
- (1)
- (4)
- (50)
- (1)
- (1)
- (815)
- (1)
- (1)
- (2)
- (2)
- (32)
- (40)
- (4)
- (6)
- (3)
- (6)
- (1)
- (3)
- (1)
- (3)
- (3)
- (31,160)
- (9)
- (1)
- (29)
- (2,893)
- (74)
- (89)
- (275)
- (2)
- (55)
- (29,965)
- (29,827)
- (6)
- (32,469)
- (16)
- (29,774)
- (45)
- (866)
- (48)
- (595)
- (30,794)
- (1)
- (32,527)
- (1)
- (3)
- (1)
- (73)
- (3)
- (30,317)
- (29,972)
- (3)
- (24,399)
- (24,961)
- (24,935)
- (24,831)
- (24,992)
- (24,794)
- (23)
- (127)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,906)
- (11)
- (3)
- (221)
- (761)
- (1,054)
- (721)
- (777)
- (920)
- (889)
- (1,009)
- (850)
- (1,470)
- (910)
- (835)
- (1,058)
- (1,059)
- (1,056)
- (681)
- (1,087)
- (30,490)
- (90)
- (9)
- (42)
- (17)
- (1)
- (103)
- (1)
- (139)
- (3)
- (79)
- (28,930)
- (28,983)
- (29,280)
- (63)
- (28,999)
- (25,597)
- (1)
- (60)
- (28,922)
- (28,575)
- (28,539)
- (17)
- (9)
- (1)
- (1)
- (7)
- (4)
- (33,652)
- (5)
- (30)
- (1)
- (1)
- (338)
- (734)
- (30,825)
- (1)
- (30,923)
- (27,238)
- (17,685)
- (17,678)
- (27,221)
- (30,927)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (99)
- (11)
- (22)
- (58)
- (26)
- (127)
- (158)
- (25)
- (84)
- (58)
- (24)
- (56)
- (75)
- (9)
- (65)
- (73)
- (95)
- (84)
- (78)
- (28)
- (64)
- (70)
- (44)
- (58)
- (50)
- (53)
- (98)
- (122)
- (41)
- (58)
- (65)
- (77)
- (75)
- (454)
- (32,846)
- (7)
- (4)
- (311)
- (417)
- (2,778)
- (3,757)
- (24)
- (3)
- (37)
- (214)
- (2,662)
- (155)
- (41)
- (27,786)
- (558)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (858)
- (142)
- (536)
- (429)
- (878)
- (402)
- (325)
- (815)
- (756)
- (721)
- (2)
- (630)
- (722)
- (290)
- (752)
- (822)
- (634)
- (807)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (11)
- (6)
- (5)
- (9)
- (3)
- (8)
- (2)
- (56)
- (14)
- (542,540)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,993)
- (30,024)
- (29,977)
- (562)
- (2,894)
- (51)
- (1)
- (15)
- (1,780)
- (726)
- (3)
- (2)
- (6)
- (4)
- (5)
- (111,671)
- (68)
- (123)
- (2,111)
- (31,219)
- (221)
- (8)
- (23)
- (597,667)
- (16)
- (1)
- (800,199)
- (84,194)
- (3)
- (45,149)
- (174)
- (1)
- (1)
- (571)
- (2)
- (36)
- (23)
- (187)
- (1,232)
- (3)
- (4)
- (468)
- (98)
- (1)
- (1,429)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (164)
- (51)
- (745)
- (5)
- (8,432)
- (7,041)
- (12)
- (2)
- (1)
- (27)
- (27)
- (6)
- (161)
- (292)
- (1)
- (74)
- (2)
- (10,238)
- (43)
- (425)
- (171)
- (2,277)
- (156)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (84)
- (2)
- (23)
- (1)
- (677)
- (56)
- (8)
- (21)
- (109,131)
- (2)
- (2)
- (57)
- (70)
- (275)
- (18)
- (1,253)
- (6,085)
- (2)
- (7)
- (2)
- (2,152)
- (6)
- (57)
- (432,679)
- (31)
- (20,758)
- (15,649)
- (1,535)
- (377)
- (219)
- (79)
- (10,492)
- (4)
- (170)
- (28)
- (2)
- (28)
- (25)
- (1,047)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (92)
- (10)
- (2)
- (349,480)
- (2,675)
- (43,521)
- (93)
- (2)
- (50)
- (41)
- (1)
- (1)
- (4)
- (167)
- (2)
- (32,406)
- (127)
- (2)
- (1)
- (2)
- (150)
- (893)
- (15,271)
- (3)
- (2)
- (168)
- (30)
- (2)
- (2)
- (10)
- (819)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (87)
- (64)
- (3)
- (337)
- (1,422)
- (2,837)
- (4)
- (290,166)
- (153,811)
- (191)
- (53)
- (197,228)
- (502,584)
- (77)
- (1,445)
- (43,004)
- (14)
- (267)
- (12,831)
- (529,517)
- (202)
- (609)
- (2)
- (3)
- (551)
- (6)
- (4)
- (211,654)
- (2,647)
- (27)
- (10)
- (51)
- (526)
- (25)
- (270)
- (1,156)
- (1,424)
- (7)
- (8)
- (1,339)
- (4)
- (2)
- (3)
- (25)
- (6,535)
- (1)
- (6)
- (813)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (48)
- (1,208)
- (2)
- (16)
- (1,835)
- (1)
- (4)
- (2)
- (261)
- (437)
- (1,279)
- (39)
- (6)
- (43,436)
- (22)
- (1)
- (917)
- (85)
- (835)
- (1,910)
- (5)
- (2)
- (3)
- (2)
- (2)
- (22,381)
- (10)
- (1)
- (4)
- (1,390)
- (9)
- (2)
- (4)
- (135)
- (2)
- (1)
- (2,798)
- (105)
- (3)
- (13)
- (33)
- (1,513)
- (5)
- (2)
- (9,778)
- (4,867)
- (3,679)
- (1)
- (41)
- (11)
- (4,367)
- (2)
- (460)
- (442)
- (4)
- (26)
- (14)
- (52)
- (14)
- (2,634)
- (258)
- (3)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1,080,854)
- (3)
- (9,440)
- (19)
- (1)
- (51)
- (10)
- (74)
- (3)
- (3)
- (90)
- (40)
- (106)
- (494)
- (5)
- (728)
- (150)
- (62)
- (882)
- (8)
- (35)
- (8)
- (22)
- (5)
- (4)
- (2)
- (867)
- (2)
- (2,269)
- (51)
- (2)
- (5,098)
- (436)
- (1)
- (4)
- (24)
- (3)
- (4)
- (4)
- (8)
- (1)
- (2)
- (19,897)
- (1,027)
- (2,074)
- (426)
- (62)
- (1,190)
- (4)
- (9)
- (53)
- (9)
- (4)
- (47)
- (8)
- (29,697)
- (821)
- (2)
- (2)
- (4)
- (8)
- (5)
- (1,305)
- (9,923)
- (376)
- (1,447)
- (20)
- (855)
- (4)
- (2)
- (30)
- (2)
- (1)
- (1,022)
- (3)
- (9)
- (1)
- (18)
- (3)
- (2)
- (1,266)
- (3,505)
- (371)
- (2)
- (42)
- (5)
- (3)
- (4)
- (3)
- (6)
- (1,889)
- (12)
- (39)
- (4)
- (2,383)
- (164)
- (135)
- (50)
- (1,477)
- (263)
- (2)
- (14)
- (18)
- (1)
- (21)
- (4,674)
- (173)
- (44)
- (1)
- (2)
- (2)
- (5,218)
- (68)
- (578)
- (300)
- (3)
- (108)
- (1)
- (1,572)
- (43)
- (4)
- (2)
- (9)
- (497)
- (21)
- (352)
- (3)
- (3)
- (6)
- (149)
- (145)
- (1)
- (1,779)
- (126)
- (168)
- (42)
- (3)
- (2)
- (176)
- (1)
- (2)
- (36)
- (3,494)
- (218)
- (407)
- (1)
- (274)
- (240)
- (236)
- (160)
- (9)
- (15)
- (11)
- (5)
- (5,223)
- (308)
- (6)
- (10)
- (1)
- (4)
- (52)
- (23)
- (73)
- (2)
- (28)
- (709)
- (1,433,637)
- (695)
- (9)
- (19)
- (1)
- (5)
- (78)
- (519)
- (89)
- (57)
- (15)
- (80)
- (42)
- (441)
- (524)
- (3)
- (15)
- (4)
- (17)
- (107)
- (9)
- (17)
- (2)
- (24)
- (1)
- (24)
- (2)
- (2)
- (16)
- (59)
- (2)
- (18)
- (2)
- (496)
- (8)
- (1)
- (890)
- (1,201)
- (2)
- (8)
- (4)
- (59)
- (139)
- (4)
- (268)
- (1)
- (13)
- (23,996)
- (90)
- (8)
- (2)
- (3)
- (1)
- (571,346)
- (4,877)
- (1,533)
- (1)
- (254)
- (2)
- (3)
- (30)
- (28)
- (8)
- (798)
- (7,443)
- (5)
- (4)
- (46)
- (1,310)
- (23)
- (279)
- (113)
- (1)
- (143)
- (182)
- (1)
- (3)
- (13)
- (20)
- (62)
- (5)
- (6)
- (9)
- (17)
- (207)
- (18)
- (18,491)
- (545)
- (215)
- (25)
- (1,234)
- (6)
- (1)
- (3)
- (1)
- (3)
- (124)
- (11)
- (5)
- (14,722)
- (155)
- (401)
- (10)
- (4)
- (6)
- (62)
- (10,252)
- (532)
- (4)
- (10)
- (2)
- (338,661)
- (5,177)
- (2)
- (6)
- (399)
- (2)
- (33)
- (2,777)
- (1,119)
- (3)
- (10)
- (30)
- (65)
- (153)
- (57)
- (2)
- (247)
- (31)
- (36)
- (3)
- (951)
- (2)
- (5,182)
- (2)
- (1)
- (15)
- (2)
- (22)
- (1)
- (1)
- (2)
- (13)
- (1)
- (2)
- (1)
- (13)
- (3,894)
- (471)
- (1)
- (2)
- (19)
- (5)
- (6)
- (3)
- (9)
- (54)
- (8)
- (3)
- (1)
- (4)
- (87)
- (10)
- (2)
- (24)
- (2)
- (2)
- (42)
- (3)
- (2)
- (2)
- (23)
- (82)
- (2,574)
- (1)
- (8)
- (23)
- (2)
- (3)
- (1,402)
- (6)
- (22)
- (13)
- (4)
- (4)
- (202)
- (5)
- (1,337)
- (38)
- (6)
- (3)
- (19,928)
- (2)
- (50)
- (2)
- (5)
- (3)
- (148)
- (339)
- (183)
- (2,287)
- (1,820)
- (30)
- (16)
- (2)
- (2)
- (4,513)
- (5)
- (9)
Filtered Search Results
IL-17A Monoclonal Antibody (eBio17B7), Brilliant Ultra Violet™ 737, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse,Rat |
| Host Species | Rat |
| Conjugate | Brilliant Ultraviolet 737 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2a κ |
| Gene Accession No. | Q61453, Q62386 |
| Concentration | 0.2 mg/mL |
| Antigen | IL-17A |
| Gene Symbols | IL17A |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | Ctla8; CTLA-8; cytokine; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; il 17; Il17; IL-17; IL17A; IL-17a; ILN; Interleukin; interleukin 17; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); interleukin 17 precursor; interleukin 17A; interleukin-17; Interleukin17A; interleukin-17A; R-IL-17-A |
| Gene | IL17A |
| Product Type | Antibody |
| Gene ID (Entrez) | 16171, 301289 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | eBio17B7 |
Invitrogen™ CD38 Monoclonal Antibody (HB7), PE, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | PE |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P28907 |
| Isotype | IgG1 κ |
| Concentration | 5 μL/Test |
| Antigen | CD38 |
| Gene Symbols | CD38 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 2'-phospho-ADP-ribosyl cyclase; 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase; 2'-phospho-cyclic-ADP-ribose transferase; ADPRC 1; ADPRC1; ADP-ribosyl cyclase 1; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1; cADPr hydrolase 1; Cd38; CD38 antigen; CD38 antigen (ADP-ribosyl cyclase / cyclic ADP-ribose hydrolase); CD38 antigen (p45); CD38 antigen p45; CD38 molecule; CD38H; Cd38-rs1; cluster of differentiation 38; cyclic ADP-ribose hydrolase 1; ecto-nicotinamide adenine dinucleotide glycohydrolase; I-19; NAD(+) nucleosidase; NAD+ nucleosidase; NIM-R5 antigen; T10 |
| Gene | CD38 |
| Product Type | Antibody |
| Gene ID (Entrez) | 952 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HB7 |
Invitrogen™ IRF1 Recombinant Rabbit Monoclonal Antibody (SR44-08)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Western Blot |
| Form | Liquid |
| Gene Accession No. | P10914, P15314, P23570 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | IRF1 |
| Gene Symbols | IRF1 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | AU020929; Interferon regulatory factor 1; interferon regulatory factor 1 isoform +I9; interferon regulatory factor 1 isoform d78; interferon regulatory factor 1 isoform delta4; interferon regulatory factor 1 isoform delta7; IRF1; IRF-1; MAR |
| Gene | IRF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 16362, 24508, 3659 |
| Formulation | TBS with 0.05% BSA, 40% Glycerol and 0.05% sodium azide; pH 7.4 |
| Immunogen | Recombinant protein within Human IRF1 aa 86-325. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SR44-08 |
Invitrogen™ CD8a Monoclonal Antibody (OX8), PE, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Rat |
| Host Species | Mouse |
| Conjugate | PE |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P05541, P07725 |
| Isotype | IgG1 κ |
| Concentration | 0.2 mg/mL |
| Antigen | CD8a |
| Gene Symbols | Cd8a, CD8B |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | BB154331; CD8; CD8 alpha; CD8 alpha chain; CD8 alpha chain precursor; CD8 antigen; CD8 antigen 32 kDa chain; CD8 antigen 37 kDa chain; CD8 antigen alpha polypeptide; CD8 antigen alpha protein; CD8 antigen alpha protein precursor; CD8 antigen alpha-chain; CD8 antigen beta polypeptide; CD8 antigen beta polypeptide precursor; CD8 antigen beta-chain; CD8 antigen, alpha chain; CD8 antigen, alpha polypeptide; CD8 antigen, alpha polypeptide (p32); CD8 antigen, alpha-chain; CD8 antigen, beta chain; CD8 antigen, beta chain 1; CD8 antigen, beta polypeptide; CD8 antigen, beta polypeptide 1 (p37); CD8 antigen, beta-chain; CD8 beta; CD8 beta chain; CD8 beta-2; CD8a; CD8A antigen alpha; CD8a molecule; CD8A; T-cell surface glycoprotein; CD8alpha; CD8B; CD8b antigen; CD8b molecule; CD8b molecule pseudogene; Cd8b1; CD8beta; CD8BP; fCD8; LEU2; Leu-2; Leu2 T-lymphocyte antigen; leu-2a; Ly-2; LY3; Ly-3; Ly-35; Ly-B; Ly-C; Lymphocyte antigen 3; Lyt2; Lyt-2; Lyt-2.1 lymphocyte differentiation antigen (AA at 100); Lyt3; Lyt-3; MAL; membrane glycoprotein; membrane protein; OKT8 T-cell antigen; OX-8 membrane antigen; p32; P37; RHACD8-4; T cell co-receptor; T lymphocyte surface glycoprotein beta chain; T8 T-cell antigen; T-cell antigen Leu2; T-cell membrane glycoprotein Ly-3; T-cell surface glycoprotein; T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 beta chain; T-cell surface glycoprotein Lyt-2; T-cell surface glycoprotein Lyt-3; T-cell surface molecule; T-lymphocyte differentiation antigen T8/Leu-2; type I transmembrane glycoprotein |
| Gene | CD8B |
| Product Type | Antibody |
| Gene ID (Entrez) | 24930, 24931 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | OX8 |
CD2 Monoclonal Antibody (RPA-2.10), FITC, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Baboon,Chimpanzee,Cynomolgus Monkey,Human,Monkey,Pig,Rhesus Macaque |
| Host Species | Mouse |
| Conjugate | FITC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Concentration | 5 μL/Test |
| Antigen | CD2 |
| Gene Symbols | CD2 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene | CD2 |
| Product Type | Antibody |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | RPA-2.10 |
Invitrogen™ CD14 Monoclonal Antibody (61D3), Super Bright™ 702, eBioscience™
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Super Bright 702 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P08571 |
| Isotype | IgG1 κ |
| Concentration | 5 μL/Test |
| Antigen | CD14 |
| Gene Symbols | Cd14 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | CD 14; CD14; CD14 antigen; CD14 molecule; cd14 monocyte; lipopolysaccharide receptor; lipoprotein receptor; LPSR antibody; monocyte differentiation antigen CD14; Monocyte differentiation antigen CD14, membrane-bound form; Monocyte differentiation antigen CD14, urinary form; monocyte differentiation antigen CD14; LOW QUALITY PROTEIN: monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein; myeloid membrane glycoprotein precursor; sCD14; soluble CD14 |
| Gene | Cd14 |
| Product Type | Antibody |
| Gene ID (Entrez) | 929 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 61D3 |
c-Met Monoclonal Antibody (eBioclone 97), eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C |
|---|---|
| Target Species | Human |
| Host Species | Rat |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | P08581 |
| Concentration | 0.5 mg/mL |
| Antigen | c-Met |
| Gene Symbols | MET |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene | MET |
| Product Type | Antibody |
| Gene ID (Entrez) | 4233 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | eBioclone 97 |
Invitrogen™ IL-33 Recombinant Rabbit Monoclonal Antibody (1H1L9)
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Liquid |
| Gene Accession No. | O95760, Q01638 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | IL-33 |
| Gene Symbols | IL1rl1, IL33 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 9230117N10Rik; C9orf26; DVS27; DVS27-related protein; H-IL-33; IL1F11; IL-1F11; Il33; IL-33; ILN; Interleukin; interleukin 33; interleukin-1 family member 11; Interleukin33; Interleukin-33; Interleukin-33 (109-270); Interleukin-33 (95-270); Interleukin-33 (99-270); Interleukin-33(102-266); Interleukin-33(109-266); NFEHEV; NFHEV; NF-HEV; nuclear factor for high endothelial venules; nuclear factor from high endothelial venules; RGD1311155; RP11-575C20.2 |
| Gene | IL33 |
| Product Type | Antibody |
| Gene ID (Entrez) | 90865, 9173 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Recombinant protein corresponding to amino acids 112-270 of human interleukin 33. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | 1H1L9 |
Invitrogen™ GABBR2 Monoclonal Antibody (5G7F7)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O75899 |
| Isotype | IgG2a |
| Concentration | 1 mg/mL |
| Antigen | GABBR2 |
| Gene Symbols | GABBR2 |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | FLJ36928; G protein-coupled receptor 51; GABA BR; GABA-B R2 receptor; GABA-B receptor 2; GABA-B receptor, R2 subunit; GABABR2; GABA-BR2; GABA-B-R2; Gabbr2; gamma-aminobutyric acid; gamma-aminobutyric acid (GABA) B receptor 2; gamma-aminobutyric acid (GABA) B receptor, 2; gamma-aminobutyric acid B receptor 2; gamma-aminobutyric acid type B receptor subunit 2; gamma-aminobutyric acid type B receptor, subunit 2; gb2; Gm425; Gpr51; GPRC3B; G-protein coupled receptor 51; HG20; HRIHFB2099; MGC119386; MGC119388; MGC119389; ortholog of human G protein-coupled receptor 51 GPR51; RP23-337N2.1 |
| Gene | GABBR2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 9568 |
| Formulation | PBS with 0.05% sodium azide |
| Immunogen | Purified recombinant fragment of human GABBR2 (aa: 319-483) expressed in E. Coli. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 5G7F7 |
Invitrogen™ SERCA2 ATPase Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | O55143, P11507, P16615 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | SERCA2 ATPase |
| Gene Symbols | Atp2a2 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 9530097L16Rik; ATP2; Atp2a2; ATP2B; ATPase Ca++ transporting cardiac muscle slow twitch 2; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2; ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2; ATPase, Ca++ transporting, slow twitch 2; Ca(2+)-transport ATPase class 3; calcium ATPase; calcium pump 2; calcium-ATPase (EC 3.6.1.3); calcium-transporting ATPase; calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform; cardiac Ca2+ ATPase; D5Wsu150e; DAR; DD; endoplasmic reticulum class 1/2 Ca(2+) ATPase; mKIAA4195; putative SERCA isoform; sarco(endo)plasmic reticulum Ca(2+)-dependent ATPase 2; sarco/endoplasmic reticulum Ca2+-ATPase 2; sarcoplasmic reticulum Ca2+-transport ATPase isoform; sarcoplasmic/endoplasmic reticulum calcium ATPase 2; sarcoplasmic/endoplasmic-reticulum Ca(2+) pump gene 2; SERCA; SERCA ATPase; SERCA2; Serca2a; SERCA2B; SercaII; SR Ca(2+)-ATPase 2; unnamed protein product |
| Gene | Atp2a2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11938, 29693, 488 |
| Formulation | PBS with 4mg trehalose and no preservative |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA2 ATPase (1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Tyrosine Hydroxylase Recombinant Rabbit Monoclonal Antibody (9H8L15)
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P07101, P24529 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | Tyrosine Hydroxylase |
| Gene Symbols | TH |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | dystonia 14; DYT14; DYT5b; EC 1.14.16.2; HGNC:11782; Th; TH isoform 3; TH isoform a; th1; TH-4; The; TY3H; TYH; TYH antibody; Tyrosine 3-hydroxylase; tyrosine 3-monooxygenase; tyrosine hydroxylase |
| Gene | TH |
| Product Type | Antibody |
| Gene ID (Entrez) | 21823, 7054 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Protein corresponding to Human TH (aa 64-269). |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | 9H8L15 |
Invitrogen™ ARHGEF19 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | Q8IW93 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | ARHGEF19 |
| Gene Symbols | ARHGEF19 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 6030432F23; 6430573B13Rik; Arhgef19; Ephexin-2; Rho guanine nucleotide exchange factor (GEF) 19; Rho guanine nucleotide exchange factor 19; weakly similar to Rho GEF; weakly similar to Rho GEF 5; Wgef |
| Gene | ARHGEF19 |
| Product Type | Antibody |
| Gene ID (Entrez) | 128272 |
| Formulation | PBS with 50% glycerol and 0.02% sodium azide; pH 7.4 |
| Immunogen | A synthesized peptide derived from human ARHGEF19(Accession Q8IW93), corresponding to amino acid residues L80-H130. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ CD20 Recombinant Rat Monoclonal Antibody (AISB12)
Rat Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Western Blot |
| Form | Liquid |
| Gene Accession No. | P19437 |
| Isotype | IgG2a |
| Concentration | 1 mg/mL |
| Antigen | CD20 |
| Gene Symbols | Ms4a1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AA960661; APY; ATOPY; B1; B-cell differentiation antigen Ly-44; B-lymphocyte antigen CD20; B-lymphocyte cell-surface antigen B1; B-lymphocyte surface antigen B1; Bp35; Cd20; CD20 antigen; CD20 cell surface protein; CD20 receptor; CVID5; EGK_06167; Fc epsilon receptor I beta chain; Fc Fragment of IgE high affinity I receptor for beta polypeptide; FCER1B; High affinity immunoglobulin epsilon receptor subunit beta; IgE Fc receptor subunit beta; IGEL; IGER; IGHER; LEU16; LEU-16; Leukocyte surface antigen Leu-16; Ly44; Ly-44; Lymphocyte antigen 44; membrane spanning 4-domains A1; membrane-spanning 4-domains subfamily A member 1; membrane-spanning 4-domains, subfamily A, member 1; membrane-spanning 4-domains, subfamily A, member 2; MGC3969; MS4A1; MS4A2; S7 |
| Gene | Ms4a1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 12482 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | AISB12 |
Invitrogen™ CYP2E1 Recombinant Rabbit Monoclonal Antibody (JM10-85)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Western Blot |
| Form | Liquid |
| Gene Accession No. | P05181, P05182, Q05421 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | CYP2E1 |
| Gene Symbols | Cyp2e1 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 4-nitrophenol 2-hydroxylase; CP2E1; CPE1; Cyp2e; Cyp2e1; Cyp2e-1; CYPIIE1; cytochrome P450 2E1; cytochrome P450 family 2 subfamily E member 1; cytochrome P450 subfamily 2e1 (ethanol-inducible); cytochrome P450, 2e1, ethanol inducible; cytochrome P450, family 2, subfamily e, polypeptide 1; cytochrome P450, subfamily 2E, polypeptide 1; cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1; cytochrome P450-ALC; Cytochrome P450-J; cytochrome P450RLM6; flavoprotein-linked monooxygenase; microsomal monooxygenase; P450C2E; P450-J; P450RLM6; xenobiotic monooxygenase |
| Gene | Cyp2e1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 13106, 1571, 25086 |
| Formulation | TBS with 0.05% BSA, 40% Glycerol and 0.05% sodium azide; pH 7.4 |
| Immunogen | Synthetic peptide within Human CYP2E1 aa 71-114. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | JM10-85 |
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | A6NFN3, Q8BIF2 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | NeuN |
| Gene Symbols | RBFOX3 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | D11Bwg0517e; FLJ56884; FLJ58356; fox 1 homolog (C. elegans) 3; fox1 homolog C; Fox-1 homolog C; FOX3; FOX-3; FOX3NeuN; hexaribonucleotide binding protein 3; hexaribonucleotide binding protein 3 (HRNBP3); Hexaribonucleotide-binding protein 3; Hrnbp3; NEUN; NeuN antigen; Neuna60; neuronal nuclear antigen A60; neuronal nuclei; Neuronal nuclei antigen; RBFOX3; RFOX3; RGD1560070; RNA binding fox-1 homolog 3; RNA binding protein; RNA binding protein fox-1 homolog 3; RNA binding protein, fox-1 homolog (C. elegans) 3; RNA binding protein, fox-1 homolog 3 |
| Gene | RBFOX3 |
| Product Type | Antibody |
| Gene ID (Entrez) | 146713, 287847, 52897 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Protein corresponding to Human RBFOX3 (aa 1-312). |
| Classification | Recombinant Superclonal |
| Primary or Secondary | Primary |
| Clone | 14HCLC |