Chicken Secondary Antibodies
Encor Biotechnology Inc CHICKEN POLYCLONAL AB
Chicken Polyclonal to Peripherin, PRPH.500UL OF IGy PREP
Cayman Chemical AB-CHMINACA metabolIte M2 1mg
Immunogen Fusion protein amino acids 2-77 of human KCNQ Host Mouse Species Reactivity ( ) Human mouse rat Applications ICC/IF IHC IP WB
Cayman Chemical AB-CHMINACA metabolIte M1B 1mg
A very long chain fatty acid (241n-9) enriched in nervous tissue and particularly abundant in sphingolipids such as sphingomyelin poorly produced in demyelinating disorders including multiple sclerosis and adrenoleukodystrophy binds and inhibits DNA polymerase B (Ki 4.0 uM) and HIV-1 reverse transcriptase (Ki 1.2 UM)
Cayman Chemical AB-CHMINACA metabolIte M3A 1mg
A selective activator of PKM2 (AC50 38 nM in vitro EC50 19.6 UM in cells) converts PKM2 to a constitutively active enzyme state that is resistant to inhibition by tyrosine-phosphorylated proteins
Cayman Chemical 4-cyno AB-BUTICA 1mg
A hexapeptide fragment of eledoisin induces contractions in isolated guinea pig ileum as well as a-amylase release from rat parotid gland slices in a concentration-dependent manner intrathecal administration of ERP (1 25-10 Ug/animal) reduces tail flick latency in the hot plate test
Kingfisher Biotech Inc Chicken ANG-4 Protein
The Chicken ANG-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken ANG-4 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken ANG-4 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken ANG-4 Specifications: (Molecular Weight: 13.8 kDa) (Amino Acid Sequence: QNEGYEKFLR QHYDAKPKGR DDRYCESMMK ERKLTSPCKD VNTFIHGTKK NIRAICGKKG SPYGENFRIS NSPFQITTCT HSGASPRPPC GYRAFKDFRY IVIACEDGWP VHFDESFISP (120)) (Gene ID: 100302572). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken TNFSF15 Recombinant Protein
The Chicken TNFSF15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken TNFSF15 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IL-4 Recombinant Protein
The Chicken IL-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-4 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-4 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-8 Specifications: (Molecular Weight: 12.4 kDa) (Amino Acid Sequence: LQLSVPLMES IRIVNDIQGE VSCVKMNVTD IFADNKTNNK TELLCKASTI VWESQHCHKN LQGLFLNMRQ LLNASSTSLK APCPTAAGNT TSMEKFLADL RTFFHQLAKN K) (Gene ID: 416330). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IFN gamma Recombinant Protein
The Chicken IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN gamma Specifications: (Molecular Weight: 16.7 kDa) (Amino Acid Sequence: HTASSLNLVQ LQDDIDKLKA DFNSSHSDVA DGGPIIVEKL KNWTERNEKR IILSQIVSMY LEMLENTDKS KPHIKHISEE LYTLKNNLPD GVKKVKDIMD LAKLPMNDLR IQRKAANELF SILQKLVDPP SFKRKRSQSQ RRCNC (145)) (Gene ID: 396054). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IFN gamma Recombinant Protein
The Chicken IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN gamma Specifications: (Molecular Weight: 16.7 kDa) (Amino Acid Sequence: HTASSLNLVQ LQDDIDKLKA DFNSSHSDVA DGGPIIVEKL KNWTERNEKR IILSQIVSMY LEMLENTDKS KPHIKHISEE LYTLKNNLPD GVKKVKDIMD LAKLPMNDLR IQRKAANELF SILQKLVDPP SFKRKRSQSQ RRCNC (145)) (Gene ID: 396054). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IL-2 Recombinant Protein
The Chicken IL-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-2 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958). For research use only. Made in the USA