Chicken Secondary Antibodies
Abcam Chicken Anti-Mouse IgG H&L (Texas Red ).
Chicken Anti-Mouse IgG H&L (Texas Red ).
The product is subject to the following: Abcam Restricted Use Statement
Sigma Aldrich Fine Chemicals Biosciences 6-Hexachloro-Fluorescein Phosphoramidite configured for ABI | 1360547-55-2 | MFCD01940924 | 0.1MMOL
6-Hexachloro-Fluorescein Phosphoramidite configured for ABI | Purity: >=97% (31P-NMR); >=97.0% (reversed phase HPLC); conforms (1H-NMR) | Mol Wt: 1050.61 | 1360547-55-2 | MFCD01940924 | 0.1MMOL
Immunoreagents Inc CHICKEN A-RABBIT IGG ALP
Secondary Antibody; Chicken anti-rabbit IgG (H&L) - Affinity Pure, min x w/Hu or Mu IgG, ALP Conjugate, Host: Chicken, Format: Liq, Label: ALP, Applications: WB, ELISA
Immunoreagents Inc CHICKEN A-GOAT IGG BIO 0.5MG
Secondary Antibody; Chicken anti-goat IgG (H&L), Affinity Pure, min x w/Hu,Mu or RB IgG/SP, Biotin Conjugate, Host: Chicken, Format: Liq, Label: Biotin, Applications: WB, ELISA, IHC/ICC
CPC Scientific (Suc-Ala-Ala-Pro-Phe)2-R110 0.5MG
Chymotrypsin.SEQUENCE: (Suc-Ala-Ala-Pro-Phe)2-R110ONE-LETTER SEQUENCE: (Suc-AAPF)2-R110MOLECULAR FORMULA: C68N74N10O17MOLECULAR WEIGHT: 1304.4STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: SYNONYMS: RESEARCH AREA: ApoptosisREFERENCES:Biol Chem Hoppe-Seyler 373, 433 (1992)Nature 361, 274 (1993)SKU(s): SUBS-007A, SUBS-007B
CPC Scientific H-Cys-Ala-Ser-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (trifluoroacetate salt) 0.5MG
Single chain peptide with 32 amino acids that stimulates bone formation by inhibiting osteoblasts, induces bone reabsorption and increases cAMP levels in osteoclasts.ONE-LETTER SEQUENCE: CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Cys1 and 7 bridge)MOLECULAR FORMULA: C145H240N42O46S2MOLECULAR WEIGHT:3371.9STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [100016-62-4], RESEARCH AREA: OsteoporosisREFERENCES: T. Kurihara et al., Peptide Chemistry, 1985, 173 (1986)
Immunoreagents Inc CHICKEN A-RAT IGG ALP
Secondary Antibody; Chicken anti-rat IgG (H&L) - Affinity Pure, min x w/Hu or Rb IgG or Serum Proteins, ALP Conjugate, Host: Chicken, Format: Liq, Label: ALP, Applications: WB, ELISA
Immunoreagents Inc CHICKEN A-RAT IGG AP
Secondary Antibody; Chicken anti-rat IgG (H&L) - Affinity Pure, Host: Chicken, Format: Liq, Label: None, Applications: WB, ELISA, IHC/ICC, IF, IP, FC