Goat Secondary Antibodies
Cayman Chemical 2,3,5,4'-Tetrahydroxyl-diphenylethylene 2-O-β-D-Glucoside, Purity: ≥98%, CAS: 82373-94-2, 50 mg
A stilbene glucoside with diverse biological activities; scavenges DPPH radicals in a cell-free assay (IC50 = 40 µM); inhibits doxorubicin-induced apoptosis, loss of mitochondrial membrane potential, and generation of ROS in mouse cardiomyocytes; increases acetylcholine-induced relaxation of, and NO levels in, aortic rings isolated from a rat model of diet-induced atherosclerosis at 30, 60, and 120 mg/kg; reduces infarct area and neuronal apoptosis in a mouse model of MCAO-induced ischemia and reperfusion injury at 15a
Cayman Chemical Cefadroxil (hydrate), Purity: ≥98%, CAS: 66592-87-8, 250 mg
A semisynthetic cephalosporin antibiotic; active against B. anthracis, V. cholerae, and P. multocida strains (MICs = 1, 2, and 4 µg/ml, respectively), among others; protective against infection by strains of S. pyogenes, S. pneumoniae, or S. aureus in mice (PD50s = 0.6-2.4, 18-24, and 0.3-29 mg/kg, respectively)
ABclonal Technology 647 anti-Human CD225/IFITM1
Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins The family contains five members including IFITM1 IFITM2 and IFITM3 that belong to the CD225 superfamily The protein encoded by this gene restricts cellular entry by diverse viral pathogens such as influenza A virus Ebola virus and Sars-CoV-2
Seracare Life Sciences Inc ANTI-HU IGA+IGG+IGM (H+L) AB
Affinity purified polyclonal secondary antibody against Human IgA, human IgG, and human IgM, both heavy and light chains (whole IgA, IgM, and IgG) made in Goat. Product is in lyophilized form.
Seracare Life Sciences Inc ANTI-RB IGG (H+L) AB HSA DL800
Affinity purified polyclonal antibody to Rabbit IgG, both heavy and light chains (whole IgG) made in Goat and labeled with DyLight 800. Product has been cross-adsorbed to human serum to minimize cross-reactivity to human immunoglobulin. Product is in lyophilized form. The conjugate is designed for use in a variety of immunofluorescense assays, including immunohistology, flow cytometry, Western blotting, microarrays and Fluorophore-Linked Immunosorbent Assays (FLISA).
Seracare Life Sciences Inc ANTI-RB IGG (H+L) AB HSA FITC
Affinity purified polyclonal antibody to Rabbit IgG, both heavy and light chains (whole IgG) made in Goat and labeled with fluorescein isothiocyanate (FITC). Product has been cross- adsorbed to human serum to minimize cross-reactivity.
Seracare Life Sciences Inc ANTI-RAT IGG (GAMMA) AB HRP
Affinity purified polyclonal secondary antibody against Rat IgG, heavy chains (gamma) made in Goat and labeled with horseradish peroxidase. Product is in lyophilized form.
Seracare Life Sciences Inc ANTI-DOG IGM (MU) AB AP
Affinity purified polyclonal secondary antibody against Dog IgM, heavy chains (mu) made in Goat and labeled with alkaline phosphatase. Product is in lyophilized form. Each lot is tested to assure specificity and lot-to-lot consistency using KPL's in-house ELISA assay.
Seracare Life Sciences Inc ANTI-HU IGM (MU) AB DL488
Affinity purified polyclonal antibody to Human IgM heavy chains (mu) made in Goat and labeled with DyLight 488. Product is in lyophilized form. The conjugate is designed for use in a variety of immunofluorescense assays, including immunohistology, flow cytometry, Western blotting, microarrays and Fluorophore-Linked Immunosorbent Assays (FLISA).
Seracare Life Sciences Inc ANTI-RB IGG(H+L) AB HSA DL680
Affinity purified polyclonal antibody to Rabbit IgG, both heavy and light chains (whole IgG) made in Goat and labeled with DyLight 680. Product has been cross-adsorbed to human serum to minimize cross-reactivity to human immunoglobulin. Product is in lyophilized form. The conjugate is designed for use in a variety of immunofluorescense assays, including immunohistology, flow cytometry, Western blotting, microarrays and Fluorophore-Linked Immunosorbent Assays (FLISA).
Seracare Life Sciences Inc ANTI-HU IGG (GAMMA) AB DL488
Affinity purified polyclonal antibody to Human IgG heavy chains (gamma) made in Goat and labeled with DyLight 488. Product is in lyophilized form. The conjugate is designed for use in a variety of immunofluorescense assays, including immunohistology, flow cytometry, Western blotting, microarrays and Fluorophore-Linked Immunosorbent Assays (FLISA).
Seracare Life Sciences Inc ANTI-HORSE IGG (GAMMA) AB AP
Affinity purified polyclonal secondary antibody against Horse IgG, heavy chains (gamma) made in Goat and labeled with alkaline phosphatase. Product is in lyophilized form. Each lot is tested to assure specificity and lot-to-lot consistency using KPL's in-house ELISA assay.
Seracare Life Sciences Inc ANTI-RB IGG(H+L) AB HSA RESAP
Affinity purified polyclonal antibody to Rabbit IgG heavy and light chains (whole IgG) made in Goat and labeled with alkaline phosphatase. ReserveAP conjugates represent the latest advances in KPL's conjugation chemistry and are more sensitive than KPL's standard AP conjugates. Product has been cross-adsorbed to human serum to minimize cross-reactivity to human immunoglobulin. Product is in lyophilized form. Each lot is tested to assure specificity and lot-to-lot consistency using KPL's in-house ELISA assay.
Seracare Life Sciences Inc ANTI-MS IGM (U) AB HSA DL488
Affinity purified polyclonal antibody to Mouse IgM heavy chains (mu) made in Goat and labeled with DyLight 488. Cross-reactivity with human serum has been minimized with affinity procedures. Product is in lyophilized form. The conjugate is designed for use in a variety of immunofluorescense assays, including immunohistology, flow cytometry, Western blotting, microarrays and Fluorophore-Linked Immunosorbent Assays (FLISA).
CPC Scientific H-Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY (Cys10 and 26 bridge)MOLECULAR FORMULA: C149H250N52O44S3MOLECULAR WEIGHT:3570.2STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [117345-87-6], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 155, 726 (1988)