Rat Secondary Antibodies
American Research Products Inc VivoGenie AntiHuman PDL1
VivoGenie Anti-Human PD-L1 (Atezolizumab) Biosimilar is a vivogenie with human reactivity produced in human Available in 100 mg size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
American Research Products Inc AntiHuman CD195
Anti-Human CD195 (CCR5) In Vivo Antibody - Ultra Low Endotoxin is a in vivo antibody with human reactivity produced in rat Available in 100 mg size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
Medchemexpress LLC Anti-Mouse Rat IL-17 5mg | 5mg
Anti-Mouse/Rat IL-17A Antibody (17F3) is a mouse-derived IgG1 type antibody inhibitor targeting to mouse and rat IL-17A Anti-Mouse IL-17A Antibody (17F3) can neutralize IL-17 Anti-Mouse/Rat IL-17A Antibody (17F3) can be used for the researches of infection immunology and metabolic disease such as M intracellulare infection and diabetes[1][2][3]
![Abcam Rat monoclonal [SB77e] Anti-Mouse IgG1 H&L (PE) preadsorbed](https://assets.fishersci.com/TFS-Assets/CCG/product-images/NC1870148.JPG-250.jpg)
Abcam Rat monoclonal [SB77e] Anti-Mouse IgG1 H&L (PE) preadsorbed
Rat monoclonal [SB77e] Anti-Mouse IgG1 H&L (PE) preadsorbed
The product is subject to the following: Abcam Restricted Use Statement
Hach Company Application Software Brewery Analysis
The application software LZV942 contains 12 brewery assays that conveniently upload to a DR6000 via USB. Assays are based on published and observed brewing methods according MEBAK and include procedures and calculations for: Anthocyanogens, Iron, Steam volatile phenols, Bitter units, Photometric iodine, Thiobarbituric acid number (TAN), Free amino nitrogen, Reductones, Vicinal diketones.
CPC Scientific H-His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Arg-Ser-Arg-Phe-Asn-OH (trifluoroacetate salt) 0.5MG
ONE-LETTER SEQUENCE: HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFNMOLECULAR FORMULA: C225H361N77O66S1MOLECULAR WEIGHT:5232.9STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [86472-71-1], RESEARCH AREA: HormonalREFERENCES: J. Spiess et al., Nature, 303, 532 (1983)
AbD Serotec RAT ANTI-MOUSE F4/80 ANTIGEN
Rat Anti Mouse, Specificity: F4/80 Antigen, Product Type: Monoclonal Antibody, Clone: CI:A3-1, Isotype: IgG2b, Quantity/Volume: 0.1mg, Phosphate buffered saline pH 7.4, Preservatives Stabilisers: 0.09% Sodium Azide
Biotium Human Lambda Light Chain (B-Cell Marker)(LLC/3778R), Biotin conjugate, 0.1mg/mL
This MAb is specific to lambda light chain of immunoglobulin and shows no cross-reaction with lambda light chain or any of the five heavy chains. In mammals, the two light chains in an antibody are always identical, with only one type of light chain, kappa or lambda. The ratio of Kappa to Lambda is 70:30. However, with the occurrence of multiple myeloma or other B-cell malignancies this ratio is disturbed. Antibody to the lambda light chain is reportedly useful in the identification of leukemias, plasmacytomas, and certain non-Hodgkin's lymphomas. Demonstration of clonality in lymphoid infiltrates indicates that the infiltrate is malignant. Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF405S and CF405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can giv
ABclonal Technology PE Rabbit anti-Human CD90/Thy1
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins The encoded protein is involved in cell adhesion and cell communication in numerous cell types but particularly in cells of the immune and nervous systems The encoded protein is widely used as a marker for hematopoietic stem cells This gene may function as a tumor suppressor in nasopharyngeal carcinoma Alternative splicing results in multiple transcript variants
Biotium CD86 (Dendritic Cells Maturation Marker)(C86/2160R), 1mg/mL
Recognizes a protein of 70 kDa, which is identified as CD86. CD86 is a type I transmembrane glycoprotein and a member of the immunoglobulin superfamily of cell surface receptors. It is expressed at high levels on resting peripheral monocytes and dendritic cells and at very low density on resting B and T lymphocytes. CD86 expression is rapidly upregulated by B cell specific stimuli with peak expression at 18 to 42 hours after stimulation. CD86, along with CD80/B71, is an important accessory molecule in T cell co-stimulation via its interaction with CD28 and CD152/CTLA4. Since CD86 has rapid kinetics of induction, it is believed to be the major CD28 ligand expressed early in the immune response. It is also found on malignant Hodgkin and Reed Sternberg (HRS) cells in Hodgkin's disease. Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent
Biotium CD86 (Dendritic Cells Maturation Marker)(C86/2160R), CF568 conjugate, 0.1mg/mL
Recognizes a protein of 70 kDa, which is identified as CD86. CD86 is a type I transmembrane glycoprotein and a member of the immunoglobulin superfamily of cell surface receptors. It is expressed at high levels on resting peripheral monocytes and dendritic cells and at very low density on resting B and T lymphocytes. CD86 expression is rapidly upregulated by B cell specific stimuli with peak expression at 18 to 42 hours after stimulation. CD86, along with CD80/B71, is an important accessory molecule in T cell co-stimulation via its interaction with CD28 and CD152/CTLA4. Since CD86 has rapid kinetics of induction, it is believed to be the major CD28 ligand expressed early in the immune response. It is also found on malignant Hodgkin and Reed Sternberg (HRS) cells in Hodgkin's disease. Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent