accessibility menu, dialog, popup

UserName
Viewing profile as user:

Fluorescent in situ hybridization Reagents

Chemical reagents and products designed to conduct fluorescent in situ hybridizations, a technique used to bind fluorescent probes to specific nucleic acids. Products may be available as kits.
Label or Dye 
  • (3)
  • (1)
  • (6)
  • (88)
  • (76)
  • (4)
  • (208)
  • (3)
  • (8)
  • (2)
  • (16)
  • (77)
  • (2)
  • (211)
  • (1)
  • (2)
Format 
  • (2)
  • (84)
Detection Method 
  • (5)
  • (1)
Conjugate 
  • (3)
For Use With (Application) 
  • (3)
  • (3)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (1)
  • (3)
  • (646)
  • (2)
  • (1)
  • (9)
  • (1)
  • (4)
  • (2)
  • (1)
  • (5)
  • (1)
  • (10)
  • (17)
  • (3)
  • (1)
  • (6)
  • (4)
  • (1)
  • (2)
  • (3)
  • (3)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (3)
  • (1)
  • (2)
  • (1)
  • (2)
  • (2)
  • (4)
  • (6)
  • (1)

special interests

  • (87)

Label or Dye

  • (3)
  • (1)
  • (6)
  • (88)
  • (76)
  • (4)
  • (208)
  • (3)
  • (8)
  • (2)
  • (16)
  • (77)
  • (2)
  • (211)
  • (1)
  • (2)

Format

  • (2)
  • (84)

Detection Method

  • (5)
  • (1)

Conjugate

  • (3)

For Use With (Application)

  • (3)
  • (3)

Form

  • (3)

Recombinant

  • (3)

Species

  • (3)

Type

  • (1)
166 – 180 of 900 results
166

Abnova™ ABL1 Split FISH Probe

Labeled FISH probes for identification of gene split using Fluoresecent In Situ Hybridization Technique.

Includes DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Content And Storage Store at 4°C in the dark.
Format Tube
Description DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Form Liquid
Gene ID (Entrez) 25
For Use With (Application) FISH-Ce
167

Abnova™ ACSS3/CEN12p FISH Probe

Labeled FISH probes for identification of gene amplification using Fluoresecent In Situ Hybridization Technique.

Includes DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Content And Storage Store at 4°C in the dark.
Format Tube
Description DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Form Liquid
Gene ID (Entrez) 79611
For Use With (Application) FISH-Ce
168

Abnova™ AFF1/CEN4p FISH Probe

Labeled FISH probes for identification of gene amplification using Fluoresecent In Situ Hybridization Technique.

Includes DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Content And Storage Store at 4°C in the dark.
Format Tube
Description DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Form Liquid
Gene ID (Entrez) 4299
For Use With (Application) FISH-Ce
169

Abnova™ ATM/CEN11p FISH Probe

Labeled FISH probes for identification of gene amplification using Fluoresecent In Situ Hybridization Technique.

Includes DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Target Human
Content And Storage Store at 4°C in the dark.
Format Tube
Description DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Form Liquid
Gene ID (Entrez) 472
For Use With (Application) FISH-Ce
170

Abnova™ IGH/MYC DY Translocation FISH Probe

Labeled FISH probes for identification of gene translocation using Fluoresecent In Situ Hybridization Technique.

Includes DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Target Human
Content And Storage Store at 4°C in the dark.
Format Tube
Description DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Form Liquid
Gene ID (Entrez) 3492/4609
For Use With (Application) FISH-Ce
171

Abnova™ VCL/ALK DY Translocation FISH Probe

Labeled FISH probes for identification of gene transloaction using Fluoresecent In Situ Hybridization Technique.

Includes DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Content And Storage Store at 4°C in the dark.
Format Tube
Description DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Form Liquid
Gene ID (Entrez) 7414/238
For Use With (Application) FISH-Ce
172

Abnova™ TYMP/CEN22q FISH Probe

Labeled FISH probes for identification of gene amplification using Fluoresecent In Situ Hybridization Technique.

Includes DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Content And Storage Store at 4°C in the dark.
Format Tube
Description DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Form Liquid
Gene ID (Entrez) 1890
For Use With (Application) FISH-Ce
173

Invitrogen™ Human LIMK1 (aa 557-645) Control Fragment Recombinant Protein

Recombinant Protein

ENCOMPASS_PREFERRED
Regulatory Status RUO
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Conjugate Unconjugated
Form Liquid
Formulation 1 M urea, PBS with no preservative; pH 7.4
Sequence MDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEV
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay,Control
Name Human LIMK1 (aa 557-645) Control Fragment
Recombinant Recombinant
174

Invitrogen™ Human LIMK1 (aa 128-219) Control Fragment Recombinant Protein

Recombinant Protein

ENCOMPASS_PREFERRED
Regulatory Status RUO
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Conjugate Unconjugated
Form Liquid
Formulation 1 M urea, PBS with no preservative; pH 7.4
Sequence EHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHV
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay,Control
Name Human LIMK1 (aa 128-219) Control Fragment
Recombinant Recombinant
175

Abnova™ HER2/CEN17 FISH Probe

Labeled FISH probes for identification of gene amplification using Fluoresecent In Situ Hybridization Technique.

176

Abnova™ CSF1 Split FISH Probe

Labeled FISH probes for identification of gene split using Fluoresecent In Situ Hybridization Technique.

Includes DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Target Human
Content And Storage Store at 4°C in the dark.
Format Tube
Description DAPI Counterstain (1500 ng/mL ) 125 uL for each 100 uL FISH Probe
Form Liquid
Gene ID (Entrez) 1435
For Use With (Application) FISH-Ce
177

Abnova™ PRDM14/CEN8p FISH Probe

Labeled FISH probes for identification of gene amplification using Fluoresecent In Situ Hybridization Technique.

178

Abnova™ PLS3/CENXp FISH Probe

Labeled FISH probes for identification of gene amplification using Fluoresecent In Situ Hybridization Technique.

179

Abnova™ mutaFISH™ PSCAwt RNA Probes

mutaFISH™ PSCAwt RNA Probes is designed to detect human PSCA gene on single strand RNA in cells using padlock probe and in situ rolling-circle amplification technology.

180

Abnova™ mutaFISH™ ACTBwt RNA Probes

Labeled FISH probes for identification of gene amplification using Fluoresecent In Situ Hybridization Technique.