Protein Labeling Reagents
Dojindo Molecular Technologies Inc PlasMem Bright Green dye (100 ul) offers plasma membrane staining for 24 hrs+ with clear visualization, high retentivity, low toxicity, water-soluble, no washing, applicable to live and fixed cells.
The plasma membrane consists of a lipid bilayer separating the intracellular environment from the extracellular space. Thus, the PM plays a central role in many cell behaviors such as cell migration, cell stretching, and signaling cascades. Additionally, PM dysfunction is an important biomarker because it is related to cell status and is linked to many diseases. PlasMem Bright dyes have higher retentivity on the plasma membrane. Furthermore, PlasMem Bright dyes are more water-soluble compared with other commercially available dyes and can be diluted with the culture medium. The PlasMem Bright dyes offer two different color options (green and red) and provide ready-to-use DMSO solutions. A working solution can be prepared easily via a single dilution step using growth medium or HBSS. Dojindo offers various reagents for cell membrane research. (https://www.dojindo.com/track-the-dynamics-of-plasma-membrane/)
![eMolecules Broadpharm / OG 488 Alkyne / 1mg / 795361703 / BP-40164 / / 1801181-54-3 / [null] / 449.366 / C24H13F2NO6](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502455046.PNG-250.jpg)
eMolecules Broadpharm / OG 488 Alkyne / 1mg / 795361703 / BP-40164 / / 1801181-54-3 / [null] / 449.366 / C24H13F2NO6
Broadpharm / OG 488 Alkyne / 1mg / 795361703 / BP-40164 / / 1801181-54-3 / [null] / 449.366 / C24H13F2NO6
![eMolecules Broadpharm / TAMRA-PEG4-DBCO / 1mg / 268505078 / BP-22456 / 95.000 / 1895849-41-8 / [null] / 936.075 / C54H57N5O10](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502464439.JPG-250.jpg)
eMolecules Broadpharm / TAMRA-PEG4-DBCO / 1mg / 268505078 / BP-22456 / 95.000 / 1895849-41-8 / [null] / 936.075 / C54H57N5O10
Broadpharm / TAMRA-PEG4-DBCO / 1mg / 268505078 / BP-22456 / 95.000 / 1895849-41-8 / [null] / 936.075 / C54H57N5O10
![eMolecules Broadpharm / Rhodamine Picolyl Azide / 1mg / 713699874 / BP-28123 / / / [null] / 816.820 / C36H32N8O11S2](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502469368.JPG-250.jpg)
eMolecules Broadpharm / Rhodamine Picolyl Azide / 1mg / 713699874 / BP-28123 / / / [null] / 816.820 / C36H32N8O11S2
Broadpharm / Rhodamine Picolyl Azide / 1mg / 713699874 / BP-28123 / / / [null] / 816.820 / C36H32N8O11S2
![eMolecules Broadpharm / JOE azide 5-isomer / 1mg / 761705640 / BP-28901 / / 1422178-11-7 / [null] / 587.370 / C26H20Cl2N4O8](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502460261.PNG-250.jpg)
eMolecules Broadpharm / JOE azide 5-isomer / 1mg / 761705640 / BP-28901 / / 1422178-11-7 / [null] / 587.370 / C26H20Cl2N4O8
Broadpharm / JOE azide 5-isomer / 1mg / 761705640 / BP-28901 / / 1422178-11-7 / [null] / 587.370 / C26H20Cl2N4O8
Medchemexpress LLC HY-66021 100mg Medchemexpress, 6-FAM CAS:3301-79-9 Purity:>98%
Medchemexpress, HY-66021 100mg 6-FAM CAS:3301-79-9 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
CPC Scientific 5FAM-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: 5FAM-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C164H256N50O48S4MOLECULAR WEIGHT:3824.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
Lumiprobe BDP 650/665 X NHS ester | 235439-04-0 | MFCD30182302 | 5 mg
BDP 650/665 X NHS ester | Purity: 95% | Mol Wt: 643.45 | 235439-04-0 | MFCD30182302 | 5 mg
![eMolecules Broadpharm / Cy3 DBCO / 1mg / 761705892 / BP-28967 / 95.000 / 2692677-79-3 / [null] / 758.042 / C51H57N4O2](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502460040.PNG-250.jpg)
eMolecules Broadpharm / Cy3 DBCO / 1mg / 761705892 / BP-28967 / 95.000 / 2692677-79-3 / [null] / 758.042 / C51H57N4O2
Broadpharm / Cy3 DBCO / 1mg / 761705892 / BP-28967 / 95.000 / 2692677-79-3 / [null] / 758.042 / C51H57N4O2
STA PHARMACEUTICAL US LLC Fmoc-L-Lys(5-FAM)-OH | 50 g | CAS 1242933-88-5 | MDL MFCD03787910
Fmoc-L-Lys(5-FAM)-OH is a Amino Acid reagent (Subcategory: Lys) sold by WuXi TIDES. Offered in 50 g. Store at 4 °C. SDS available for reference.
Specifications
- CAS: 1242933-88-5
- MDL: MFCD03787910
- InChIKey: ZAGGWQSWIFPNCB-DHUJRADRSA-N
- Molecular Weight: 726.738
- Molecular Formula: C42H34N2O10
- Purity: ≥95%
- Container Type: 250 mL HDPE
- Pack Size: 50 g
- Net Weight: 50 g
- Gross Weight: 89.8 g
- Commodity Code: 29322090
- Country Of Origin: China
- IUPAC: N2-(((9H-fluoren-9-yl)methoxy)carbonyl)-N6-(3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-5-carbonyl)-L-lysine
- SMILES: O=C(OCC1C2=C(C3=C1C=CC=C3)C=CC=C2)N[C@@H](CCCCNC(C4=CC5=C(C=C4)C6(C7=C(OC8=C6C=CC(O)=C8)C=C(O)C=C7)OC5=O)=O)C(O)=O
LICOR IRDye 680RD Carboxylate (100 nmol)
Assays that use IRDye 680RD conjugates (such as small animal imaging and cell binding assays) may require a "dye-only" control for potential effects or retention of the dye. Carboxylate (non-reactive) form of IRDye 680RD is an ideal control.