Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
12-Lipoxygenase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31767825UL
This item is not returnable.
View return policy
Description
12-Lipoxygenase Polyclonal antibody specifically detects 12-Lipoxygenase in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
12-Lipoxygenase | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
12(S)-lipoxygenase, 12-LOX, 12S-lipoxygenase, 12S-LOXarachidonate 12-lipoxygenase, 12S-type, arachidonate 12-lipoxygenase, EC 1.13.11, EC 1.13.11.31, LOG12, platelet 12-LOX, platelet-type 12-lipoxygenase, Platelet-type lipoxygenase 12 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: PGDNALDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLS | |
25 μg | |
Lipid and Metabolism | |
239 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction