14-3-3 beta/alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB407488	Novus Biologicals NBP18061125UL	25ul
NBP180611	Novus Biologicals NBP180611	0.1 mL

Description

14-3-3 beta/alpha Polyclonal specifically detects 14-3-3 beta/alpha in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: 14-3-3 beta/alpha
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 14-3-3 alpha, 14-3-3 beta, 14-3-3 protein beta/alpha, brain protein 14-3-3, beta isoform, GW128, HS1, KCIP-1, Protein 1054, Protein kinase C inhibitor protein 1, protein kinase C inhibitor protein-1, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alphapolypeptide, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, betapolypeptide, YWHAA
• Gene Symbols: YWHAB
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Rat, Human, Mouse
• Gene Accession No.: P31946, P31946, P31946, P31946
• Gene ID (Entrez): 7529
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only