Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
14-3-3 epsilon Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP18982725UL
Description
14-3-3 epsilon Polyclonal specifically detects 14-3-3 epsilon in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
14-3-3 epsilon | |
Polyclonal | |
Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
14-3-3 epsilon, 14-3-3 protein epsilon, FLJ45465, FLJ53559,14-3-3E, KCIP-1, MDCR, MDS, mitochondrial import stimulation factor L subunit, protein kinase C inhibitor protein-1, tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilonpolypeptide | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of human 14-3-3 epsilon antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
YWHAE | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE | |
25 μL | |
Cancer, Lipid and Metabolism | |
7531 | |
Human, Mouse, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction