14-3-3 epsilon Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP189827

Catalog No. NBP189827

Description

14-3-3 epsilon Polyclonal specifically detects 14-3-3 epsilon in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: 14-3-3 epsilon
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: 14-3-3 epsilon, 14-3-3 protein epsilon, FLJ45465, FLJ53559,14-3-3E, KCIP-1, MDCR, MDS, mitochondrial import stimulation factor L subunit, protein kinase C inhibitor protein-1, tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilonpolypeptide
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human 14-3-3 epsilon antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: YWHAE
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE
• Quantity: 0.1 mL
• Research Discipline: Cancer, Lipid and Metabolism
• Gene ID (Entrez): 7531
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only