Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ 14-3-3 zeta Monoclonal Antibody (6G5)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA549184

Catalog No. PIMA549184


Only null left
Add to Cart

Description

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human A549 whole cell, monkey COS-7 whole cell, human Raji whole cell, PC-3 cell, SiHa cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

At least seven isoforms comprise the highly conserved 14-3-3 family of homo- and heterodimeric proteins that are abundantly expressed in all eukaryotic cells. Although more than seven isoforms of 14-3-3 have been described, some redundancies have appeared upon sequencing. The 14-3-3s are thought to be key regulators of signal transduction events mediated through their binding to serine-phosphorylated proteins. By interacting with Cdc25C, 14-3-3 regulates entry into the cell cycle and through interaction with Bad, prevents apoptosis. Other proteins that have been shown to bind to 14-3-3s include members of the protein kinase C family, Cbl, IRS-1, polyoma middle-T antigen, nitrate reductase, S-raf and the IGF-1 receptor. Detection of 14-3-3 proteins in cerebrospinal fluid has been shown to be useful in the differential diagnosis of Creutzfeldt-Jakob disease and other prion diseases.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

14-3-3 zeta
Monoclonal
500 μg/mL
PBS with 4mg trehalose and 0.05mg sodium azide
P63101, P63102, P63104
Ywhaz
A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).
100 μg
Primary
Human, Mouse, Monkey, Rat
Antibody
IgG2b
Flow Cytometry, Western Blot
6G5
Unconjugated
Ywhaz
1110013I11Rik; 14-3-3 delta; 14-3-3 protein zeta/delta; 14-3-3 protein/cytosolic phospholipase A2; 14-3-3 zeta; 1433Z; 14-3-3z; 14-3-3zeta; 14-3-3-zeta; 143Z; AI596267; AL022924; AU020854; epididymis luminal protein 4; epididymis secretory protein Li 3; epididymis secretory protein Li 93; factor activating exoenzyme S; FAS; HEL4; HEL-S-3; HEL-S-93; KCIP-1; mitochondrial import stimulation factor S1 subunit; Msfs1; phospholipase A2; protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; SEZ-2; tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide; tyrosine 3/tryptophan 5-monooxygenase activation protein zeta polypeptide; tyrosine 3-monooxygenase tryptophan 5-monooxygenase activation protein; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide; YWHAD; YWHAZ
Mouse
Antigen affinity chromatography
RUO
22631, 25578, 7534
-20°C
Lyophilized
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.