Invitrogen™ 14-3-3 zeta Monoclonal Antibody (6H7)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA549185

Catalog No. PIMA549185

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human A549 whole cell, monkey COS-7 whole cell, human Raji whole cell, huamn Caco-2 whole cell, huamn Jurkat whole cell, mouse brain tissue, rat brain tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

At least seven isoforms comprise the highly conserved 14-3-3 family of homo- and heterodimeric proteins that are abundantly expressed in all eukaryotic cells. Although more than seven isoforms of 14-3-3 have been described, some redundancies have appeared upon sequencing. The 14-3-3s are thought to be key regulators of signal transduction events mediated through their binding to serine-phosphorylated proteins. By interacting with Cdc25C, 14-3-3 regulates entry into the cell cycle and through interaction with Bad, prevents apoptosis. Other proteins that have been shown to bind to 14-3-3s include members of the protein kinase C family, Cbl, IRS-1, polyoma middle-T antigen, nitrate reductase, S-raf and the IGF-1 receptor. Detection of 14-3-3 proteins in cerebrospinal fluid has been shown to be useful in the differential diagnosis of Creutzfeldt-Jakob disease and other prion diseases.

Specifications

• Antigen: 14-3-3 zeta
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P63101, P63102, P63104
• Gene Symbols: Ywhaz
• Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Monkey, Rat
• Product Type: Antibody
• Isotype: IgG1

• Applications: Western Blot
• Clone: 6H7
• Conjugate: Unconjugated
• Gene: Ywhaz
• Gene Alias: 1110013I11Rik; 14-3-3 delta; 14-3-3 protein zeta/delta; 14-3-3 protein/cytosolic phospholipase A2; 14-3-3 zeta; 1433Z; 14-3-3z; 14-3-3zeta; 14-3-3-zeta; 143Z; AI596267; AL022924; AU020854; epididymis luminal protein 4; epididymis secretory protein Li 3; epididymis secretory protein Li 93; factor activating exoenzyme S; FAS; HEL4; HEL-S-3; HEL-S-93; KCIP-1; mitochondrial import stimulation factor S1 subunit; Msfs1; phospholipase A2; protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; SEZ-2; tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide; tyrosine 3/tryptophan 5-monooxygenase activation protein zeta polypeptide; tyrosine 3-monooxygenase tryptophan 5-monooxygenase activation protein; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide; YWHAD; YWHAZ
• Host Species: Mouse
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 22631, 25578, 7534
• Content And Storage: -20°C
• Form: Lyophilized