Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
17 beta-HSD1/HSD17B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | 17 beta-HSD1/HSD17B1 |
---|---|
Dilution | Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
17 beta-HSD1/HSD17B1 Polyclonal specifically detects 17 beta-HSD1/HSD17B1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
17 beta-HSD1/HSD17B1 | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
17-beta-HSD 1, 17-beta-hydroxysteroid dehydrogenase type 1, 20 alpha-hydroxysteroid dehydrogenase, 20-alpha-HSD, E17KSR, E2DH, EC 1.1.1.62, EDH17B1, EDH17B2EDHB17, estradiol 17-beta-dehydrogenase 1, estradiol 17-beta-dehydrogenase-1, HSD17, hydroxysteroid (17-beta) dehydrogenase 1, hydroxysteroid (17-beta) dehydrogenase 1 isoform, MGC138140, Placental 17-beta-hydroxysteroid dehydrogenase, SDR28C1, short chain dehydrogenase/reductase family 28CE, member 1 | |
HSD17B1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 | |
Polyclonal | |
Rabbit | |
Breast Cancer, Cancer | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
3292 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:FGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTL | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title