4-1BB/TNFRSF9/CD137 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25643225UL

Catalog No. NB394489

Description

4-1BB/TNFRSF9/CD137 Polyclonal specifically detects 4-1BB/TNFRSF9/CD137 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: 4-1BB/TNFRSF9/CD137
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: 4-1BB, 4-1BB ligand receptor, CD137 antigen, CD137MGC2172, CDw137, FLJ43501, ILAhomolog of mouse 4-1BB, induced by lymphocyte activation (ILA), interleukin-activated receptor, homolog of mouse Ly63, receptor protein 4-1BB, T cell antigen ILA, T-cell antigen 4-1BB homolog, T-cell antigen ILA, tumor necrosis factor receptor superfamily member 9, tumor necrosis factor receptor superfamily, member 9
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TNFRSF9
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cancer, Cell Biology, Immune System Diseases, Immunology, Stem Cells
• Gene ID (Entrez): 3604
• Target Species: Human
• Form: Purified

For Research Use Only