5-Lipoxygenase Rabbit anti-Human, Mouse, Rat, Clone: 5C5Z2, Novus Biologicals™

Rabbit Monoclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB167392	Novus Biologicals NBP31615020UL	20 μg
NB167391	Novus Biologicals NBP316150100UL	100 μg

Description

5-Lipoxygenase Monoclonal antibody specifically detects 5-Lipoxygenase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: 5-Lipoxygenase
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin
• Classification: Monoclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: 5-lipoxygenase, 5-LO, 5-LOX, 5LPG, arachidonate 5-lipoxygenase, arachidonic 5-lipoxygenase alpha-10 isoform, arachidonic 5-lipoxygenase delta-10-13 isoform, arachidonic 5-lipoxygenase delta-13 isoform, arachidonic 5-lipoxygenase delta-p10 isoform, arachidonic acid 5-lipoxygenase, EC 1.13.11, EC 1.13.11.34, leukotriene A4 synthase, LOG5, MGC163204
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 5-Lipoxygenase (P09917). CYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQS
• Primary or Secondary: Primary
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.

• Clone: 5C5Z2
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Cancer, Cholesterol Metabolism, Lipid and Metabolism, Neuroscience, Signal Transduction
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Gene ID (Entrez): 240
• Isotype: IgG
• Purification Method: Affinity purified