Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AADAC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | AADAC |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
AADAC Polyclonal specifically detects AADAC in Human samples. It is validated for Western Blot.Specifications
AADAC | |
Polyclonal | |
Rabbit | |
P22760 | |
13 | |
Synthetic peptides corresponding to AADAC(arylacetamide deacetylase (esterase)) The peptide sequence was selected from the N terminal of AADAC. Peptide sequence AHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFN. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
arylacetamide deacetylase, arylacetamide deacetylase (esterase), CES5A1, DACEC 3.1.1.3, EC 3.1.1, EC 3.1.1.79 | |
AADAC | |
IgG | |
46 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title