Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AASDH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | AASDH |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
AASDH Polyclonal specifically detects AASDH in Human samples. It is validated for Western Blot.Specifications
AASDH | |
Polyclonal | |
Rabbit | |
Q4L235 | |
132949 | |
Synthetic peptides corresponding to AASDH(aminoadipate-semialdehyde dehydrogenase) The peptide sequence was selected from the middle region of AASDH. Peptide sequence TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ACSF4acyl-CoA synthetase family member 4, aminoadipate-semialdehyde dehydrogenase, EC 6.2.1.-, LYS2, non-ribosomal peptide synthetase 1098, non-ribosomal peptide synthetase 998,2-aminoadipic 6-semialdehyde dehydrogenase, NRPS1098, NRPS998, Protein NRPS998, U26 | |
AASDH | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title