ABCA13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257346

Catalog No. NBP257346

Description

ABCA13 Polyclonal specifically detects ABCA13 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ABCA13
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: ATP binding cassette transporter A13, ATP-binding cassette sub-family A member 13, ATP-binding cassette, sub-family A (ABC1), member 13, DKFZp313D2411, EC 2.7.11.25, EC 3.6.3, FLJ16398, FLJ33876, FLJ33951
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 154664
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ABCA13
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DWLPLNQTFSQVSELVLNVTISTLTFLQQHGVAVTEPVYHLSMQNIVWDPQKVQYDLKSQFGFDDLHTEQILNSSAELKEIPTDTSLEKMVCSV
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only