Invitrogen™ ABCA4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578688

Catalog No. PIPA578688

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, rat eye tissue, mouse eye tissue.

ABCA4 (ATP-Binding Cassette, Subfamily A, Member 4), also known as ABCR, is a protein which in humans is encoded by the ABCA4 gene. ABCA4 is a member of the ATP-binding cassette transporter gene sub-family A (ABC1) found exclusively in multicellular eukaryotes. Using a whole genome radiation hybrid panel, this gene is mapped to 1p21-p13. And this gene is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Additionally, it is showed by immunofluorescence microscopy and Western blot analysis that ABCR is present in foveal and peripheral cone, as well as rod, photoreceptors. The results suggested that the loss in central vision experienced by patients with Stargardt macular dystrophy arises directly from ABCR-mediated foveal cone degeneration.

Specifications

• Antigen: ABCA4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ABCA4
• Gene Alias: ABC transporter; ABC10; abca4; abca4.L; Abcr; ARMD2; ATP binding cassette subfamily A member 4; ATP binding cassette subfamily A member 4 L homeolog; ATP binding cassette transporter; ATP-binding cassette 10; ATP-binding cassette sub-family A member 4; ATP-binding cassette transporter, retinal-specific; ATP-binding cassette, subfamily A (ABC1), member 4; ATP-binding cassette, sub-family A (ABC1), member 4; ATP-binding cassette, sub-family A, member 4; ATP-binding transporter, retina-specific; AW050280; CORD3; D430003I15Rik; FFM; photoreceptor rim protein; retinal ABCA4 transporter; retinal-specific ATP-binding cassette transporter; Retinal-specific phospholipid-transporting ATPase ABCA4; retina-specific ABC transporter; RIM ABC transporter; RIM protein; RMP; RP19; Stargardt disease protein; STGD; STGD1; XELAEV_180233141mg
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 11304, 24, 310836
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4 mg trehalose and no preservative
• Gene Accession No.: O35600, P78363
• Gene Symbols: ABCA4
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA4 (1890-1927aa FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG