Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ABCB10 Antibody, Novus Biologicals™

ABCB10 Antibody, Novus Biologicals™
SDP

Catalog No. NBP169065 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169065 100 μL
NBP16906520 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP169065 Supplier Novus Biologicals Supplier No. NBP169065
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ABCB10 Polyclonal specifically detects ABCB10 in Rat samples. It is validated for Western Blot.

Specifications

Antigen ABCB10
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q5FVL8
Gene Alias ABC transporter 10 protein, ATP-binding cassette, sub-family B (MDR/TAP), member 10, EC 3.6.3, EC 3.6.3.44, EST20237, M-ABC2ATP-binding cassette transporter 10, Mitochondrial ATP-binding cassette 2, MTABC2ATP-binding cassette sub-family B member 10, mitochondrial
Gene Symbols Abcb10
Host Species Rabbit
Immunogen The immunogen for anti-Abcb10 antibody: synthetic peptide corresponding to a region of Rat (NP_001012166). Peptide sequence TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA.
Molecular Weight of Antigen 77 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23456
Test Specificity Zebrafish: 77%.
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.