Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABCB10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | ABCB10 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16906520
|
Novus Biologicals
NBP16906520UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP169065
|
Novus Biologicals
NBP169065 |
100 μL |
Each for $487.50
|
|
|||||
Description
ABCB10 Polyclonal specifically detects ABCB10 in Rat samples. It is validated for Western Blot.Specifications
| ABCB10 | |
| Polyclonal | |
| Rabbit | |
| Q5FVL8 | |
| 23456 | |
| The immunogen for anti-Abcb10 antibody: synthetic peptide corresponding to a region of Rat (NP_001012166). Peptide sequence TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ABC transporter 10 protein, ATP-binding cassette, sub-family B (MDR/TAP), member 10, EC 3.6.3, EC 3.6.3.44, EST20237, M-ABC2ATP-binding cassette transporter 10, Mitochondrial ATP-binding cassette 2, MTABC2ATP-binding cassette sub-family B member 10, mitochondrial | |
| Abcb10 | |
| IgG | |
| 77 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title