Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABCC9 Antibody (S319A-14), Alexa Fluor™ 488, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP222403AF488
Description
ABCC9 Monoclonal specifically detects ABCC9 in Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.Specifications
ABCC9 | |
Monoclonal | |
Alexa Fluor 488 | |
50mM Sodium Borate with 0.05% Sodium Azide | |
ABCC9 | |
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A | |
0.1 mL | |
10060 | |
Mouse | |
Purified |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
S319A-14 | |
Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence | |
ABC37, ATP-binding cassette, sub-family C (CFTR/MRP), member 9, CMD1OATP-binding cassette transporter sub-family C member 9, EC 3.6.3.44, FLJ36852, Sulfonylurea receptor 2, sulfonylurea receptor 2A, SUR2ATP-binding cassette sub-family C member 9 | |
Mouse | |
Protein G purified | |
Primary | |
Detects approx 120kDa. Does not cross-react with SUR2B. | |
Store at 4C in the dark. | |
IgG2a |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction