Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP222403

ABCC9 Antibody (S319A-14), Novus Biologicals™
SDP

Catalog No. NBP222403 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP222403 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP222403 Supplier Novus Biologicals Supplier No. NBP222403
Only null left
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

ABCC9 Monoclonal specifically detects ABCC9 in Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen ABCC9
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification Monoclonal
Clone S319A-14
Concentration 1 mg/mL
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500
Gene Accession No. P70170
Gene Alias ABC37, ATP-binding cassette, sub-family C (CFTR/MRP), member 9, CMD1OATP-binding cassette transporter sub-family C member 9, EC 3.6.3.44, FLJ36852, Sulfonylurea receptor 2, sulfonylurea receptor 2A, SUR2ATP-binding cassette sub-family C member 9
Gene Symbols ABCC9
Host Species Mouse
Immunogen Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Purification Method Protein G purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10060
Test Specificity Detects approx 120kDa. Does not cross-react with SUR2B.
Target Species Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.