Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abcc9, Mouse anti-Mouse, A594, Clone: S319A-14, Abnova™

Catalog No. 89338386 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-338-386 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-338-386 Supplier Abnova Corporation Supplier No. MAB18461
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

Sequence: SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK

Specifications

Antigen Abcc9
Applications Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Western Blot
Classification Monoclonal
Clone S319A-14
Conjugate Atto 594
Dilution Immunocytochemistry Immunofluorescence Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) Western Blot (1:1000) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.4 (50% glycerol, 0.09% sodium azide).
Gene ATP-binding cassette, sub-family C (CFTR/MRP), member 9
Gene Alias AI414027/AI449286/SUR2A/SUR2B/Sur2
Gene Symbols Abcc9
Host Species Mouse
Immunogen Recombinant protein corresponding to amino acids 1505-1546 at C-terminus of mouse Abcc9.
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 20928
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C.
Product Type Antibody
Form Liquid
Isotype IgG2a
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.