Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABCE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | ABCE1 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ABCE1 Polyclonal specifically detects ABCE1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
ABCE1 | |
Polyclonal | |
Rabbit | |
ABC Transporters, Immune System Diseases, Immunology, Lipid and Metabolism, Membrane Trafficking and Chaperones, Plasma Membrane Markers, Signal Transduction | |
2'-5'-oligoadenylate-binding protein, ATP-binding cassette, sub-family E (OABP), member 1, HuHP68, OABP, Ribonuclease 4 inhibitor, ribonuclease L (2'-5'-oligoisoadenylate synthetase-dependent) inhibitor, RLIABC38, RNase L inhibitor, RNASEL1, RNASELIRNS4IATP-binding cassette sub-family E member 1 | |
ABCE1 | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
6059 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title