Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABCG4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP214252
Description
ABCG4 Polyclonal specifically detects ABCG4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ABCG4 | |
Polyclonal | |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Q9H172 | |
ABCG4 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: NPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDPIESHTFATSTLT | |
0.1 mL | |
ABC Transporters, Lipid and Metabolism | |
64137 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ATP-binding cassette, sub-family G (WHITE), member 4, ATP-binding cassette, subfamily G, member 4, putative ABC transporter, WHITE2ATP-binding cassette sub-family G member 4 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction