Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578703

Invitrogen™ ABCG8 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578703
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578703 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578703 Supplier Invitrogen™ Supplier No. PA578703
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HL-60 whole cell, human K562 whole cell, human HepG2 whole cell, rat liver tissue, rat PC-12 whole cell, mouse liver tissue, mouse HEPA1-6 whole cell. ICC/IF: HepG2 cell.

ATP-binding cassette (ABC) transporter genes are involved in the regulation of the amount of dietary cholesterol retained in the body. ABCG8, expressed at high levels in the liver and intestine, normally cooperates with ABCG5 to limit intestinal absorption and promote biliary excretion of sterols. The mutated form of this transporter can lead to sterol accumulation and atherosclerosis or sitosterolemia, a rare autosomal recessive disorder, characterized by hyperabsorption of sterols and the inability to excrete sterols into bile.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ABCG8
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene Abcg8
Gene Accession No. P58428, Q9DBM0, Q9H221
Gene Alias 1300003C16Rik; ABCG8; AI114946; ATP binding cassette subfamily G member 8; ATP-binding cassette sub-family G member 8; ATP-binding cassette, subfamily G (WHITE), member 8; ATP-binding cassette, sub-family G (WHITE), member 8; ATP-binding cassette, subfamily G, member 8; GBD4; MGC142217; sterolin 2; Sterolin2; sterolin-2; STSL
Gene Symbols Abcg8
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human ABCG8 (328-371aa DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 155192, 64241, 67470
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.