ABH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP214283

Catalog No. NBP214283

Description

ABH1 Polyclonal specifically detects ABH1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ABH1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q13686
• Gene Symbols: ALKBH1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ABH1, ABHalkB, alkylation repair homolog (E. coli), alkB, alkB, alkylation repair homolog 1 (E. coli), ALKBH, alkylated DNA repair protein alkB homolog 1, alkylation repair, alkB homolog, Alpha-ketoglutarate-dependent dioxygenase ABH1, DNA lyase ABH1, EC 1.14.11.-, EC 4.2.99.18, hABH
• Host Species: Rabbit
• Molecular Weight of Antigen: 44 kDa
• Quantity: 0.1 mL
• Research Discipline: DNA Repair
• Gene ID (Entrez): 8846
• Target Species: Human
• Isotype: IgG

For Research Use Only