Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABH2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ABH2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ABH2 Polyclonal specifically detects ABH2 in Human samples. It is validated for Western Blot.Specifications
ABH2 | |
Polyclonal | |
Rabbit | |
Q6NS38 | |
121642 | |
Synthetic peptides corresponding to ALKBH2(alkB, alkylation repair homolog 2 (E. coli)) The peptide sequence was selected from the middle region of ABH2 (NP_001001655). Peptide sequence VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
2OG-Fe(II) oxy DC1, ABH2FLJ99103, alkB, alkylation repair homolog 2 (E. coli), Alkylated DNA repair protein alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase alkB homolog 2, EC 1.14.11.-, MGC90512, Oxy DC1 | |
ALKBH2 | |
IgG | |
29 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title