Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ABH2 Antibody, Novus Biologicals™
SDP

Catalog No. p-7107265 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156921 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156921 Supplier Novus Biologicals Supplier No. NBP156921
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ABH2 Polyclonal specifically detects ABH2 in Human samples. It is validated for Western Blot.

Specifications

Antigen ABH2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6NS38
Gene Alias 2OG-Fe(II) oxy DC1, ABH2FLJ99103, alkB, alkylation repair homolog 2 (E. coli), Alkylated DNA repair protein alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase alkB homolog 2, EC 1.14.11.-, MGC90512, Oxy DC1
Gene Symbols ALKBH2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ALKBH2(alkB, alkylation repair homolog 2 (E. coli)) The peptide sequence was selected from the middle region of ABH2 (NP_001001655). Peptide sequence VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL.
Molecular Weight of Antigen 29 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 121642
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Pig: 100%; Rat: 100%; Canine: 92%.
Reconstitution Centrifuge prior to reconstitution. Reconstitute with 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.